KEGG   Acetoanaerobium sticklandii: CLOST_2355Help
Entry
CLOST_2355        CDS       T01334                                 

Definition
(GenBank) putative DNA-binding protein
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cst  Acetoanaerobium sticklandii
Pathway
cst03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cst00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CLOST_2355
Enzymes [BR:cst01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CLOST_2355
DNA repair and recombination proteins [BR:cst03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CLOST_2355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 AAA_11 Viral_helicase1 HHH_5 Helicase_RecD PIF1 T2SSE UvrD_C PhoH AAA_22 DUF2442 TrwB_AAD_bind DEAD AAA AAA_24 AAA_12 RsgA_GTPase ATPase ResIII SRP54 DUF2075 Zeta_toxin NB-ARC AAA_14 MGS AAA_16 AAA_29 AAA_28
Motif
Other DBs
NCBI-ProteinID: CBH22472
UniProt: E3PUN4
Position
complement(2477112..2479355)
Genome map
AA seq 747 aa AA seqDB search
MPIELKGKISDIIFQNDENGYTIANLISDELGEVTVVGCMPSVRELDNIQVSGEWKTHDI
YGRQFSVMSFTHMAIDSLDGIIAYLASGTIEGIGLKMAHKITDKFGIKAIEILETNPNRY
LEIEGIGRKKLDKMISSHMEGRQLKSIITAFSPYGISPAYCMKIYKKYADKSIDMVMNNP
YGLCKDVKGIGFKKADEIAKKLNAGLDSLERIEEGIKYLLQEAAYSGHTYMLMPQLVSKA
KELLSIDEEEILSCLNQMAINGGITIEEVDIEQRIYLDSYNLAETRAASNLIKLAYMNEL
ENQEKTIEQLELEEDIELSELQKKAVTMALENKMMILTGGPGTGKTTTLSFIIKSFEQMK
RKIILCAPTGRAAKRMSQATLRPASTIHRLLEAVYSEEADGLIFQKDEDDPIAADVIIVD
EVSMMDVMLLDSLLLAVSENTAVIFVGDKDQLPSVGAGRVLQDMLESNTIPSIELTEVFR
QAKQSMIIVNAHKINKGELPITDQKNTDFFFMAKKTPSQIAELIVELVSDRLPKYYKLSS
NNIQVLSPMRKSEAGVLNLNLLLQEALNPARQGKREHKAGNRTFRTGDRVMHIKNNYEKT
WENLEENISGEGIFNGDLGYIDFIEPSEKKLYIQFDDGKRAEYDFTELDQIEHAFATTVH
KSQGSEFDCVVMPVSAFPPMLMSRKILYTALTRAKKLAILVGDAKYLKAMISNVYEEKRN
TALSDKLKLYKETGMLLEENNGATVPF
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgcctatagaattaaaaggaaaaatttcagatataatatttcaaaacgatgaaaatggc
tacactatagcaaacctaatcagcgatgaacttggagaagttacagtggtgggctgtatg
ccatctgtcagagagctcgacaatatacaggtcagtggagagtggaagactcacgatata
tatggcagacagtttagtgttatgagcttcactcatatggctatagattcgctagatgga
atcatagcctacctagcatctggaacgatagaaggcataggtcttaaaatggcacataaa
atcacagataaattcgggataaaagctatagaaatcctagaaactaatcctaatagatat
ttagaaatagaaggcataggcagaaaaaagctcgataaaatgataagctctcatatggaa
ggaagacagctaaaatccataataacagcattttcgccatatggaataagcccagcctac
tgcatgaaaatctataaaaaatatgcagataaatccatagatatggtcatgaacaatccc
tacggtctatgtaaggatgtaaaagggatagggtttaaaaaagctgatgaaatagcaaaa
aaattaaatgctggacttgattctttagaaagaatagaagaaggcattaaatacctgctt
caagaagctgcatatagtggacatacatatatgctaatgcctcagctagtatcaaaagcc
aaggaactgctatcaatagatgaagaagaaattctatcttgcttgaatcagatggctata
aatggaggcataaccatagaagaagtagatatagagcaaagaatctatttggattcctat
aacctagcagagacaagagcagctagcaacctaataaagctggcatatatgaacgagctt
gaaaatcaagaaaaaaccatagagcaattagagctagaagaagatatagagctgtcagag
ctacaaaaaaaagctgtgactatggcacttgaaaacaaaatgatgatattaactggtggc
ccaggaactggaaaaacgactactcttagctttataatcaaaagctttgaacagatgaag
agaaaaattatcctctgcgcaccgacaggaagagcagcgaagcgtatgtcgcaggcaacc
ttgagaccagcctctacgattcatagactactagaggcagtatatagtgaagaagcagat
ggtcttatatttcaaaaagacgaagacgaccctatagccgctgatgtaataatagtagat
gaggtttctatgatggacgtgatgctcctagatagcttgcttcttgccgtatcagagaac
acggcggttatatttgtaggagacaaagaccagcttccatcagtaggagctggaagagtc
ctacaggatatgctagagagcaataccatacctagtatagagcttacagaagtatttaga
caggcaaagcaaagcatgataatagtcaatgcccacaaaataaataaaggtgagcttccg
atcacagaccaaaaaaatacagacttcttttttatggcaaagaaaactccgtctcagata
gcagagctaatagtagagctagtttcagatagactgccaaagtactataaactatcatca
aataatattcaggtactgtcacctatgagaaaatcagaagctggagtacttaatctaaac
ctcttactacaagaagcactcaatccagcaagacaaggcaaaagagagcataaagcggga
aatagaacttttagaacgggcgatagggtaatgcacataaaaaataactatgaaaaaacc
tgggaaaacttagaagaaaatatttctggagaaggaatatttaacggcgatttaggatat
atagacttcatagagcctagtgaaaaaaaactctatattcagtttgacgatggtaaaaga
gcggaatatgactttacagagctagatcagatagagcatgcatttgctactactgttcat
aaaagccaaggctctgagtttgattgcgtagtcatgccagtatcagcttttcctcctatg
ctcatgagcagaaagattctctacacagcacttacaagagcaaaaaaactagcaatacta
gtaggtgacgcaaaatacctaaaggctatgatatccaatgtctacgaggaaaagagaaat
accgccctatctgataagttaaaactttacaaagaaactggtatgctactggaggagaat
aatggagctactgtacccttctaa

DBGET integrated database retrieval system