KEGG   Clostridium sticklandii: CLOST_2355Help
Entry
CLOST_2355        CDS       T01334                                 

Definition
putative DNA-binding protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cst  Clostridium sticklandii
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cst03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2477112..2479355)
Genome map
AA seq 747 aa AA seqDB search
MPIELKGKISDIIFQNDENGYTIANLISDELGEVTVVGCMPSVRELDNIQVSGEWKTHDI
YGRQFSVMSFTHMAIDSLDGIIAYLASGTIEGIGLKMAHKITDKFGIKAIEILETNPNRY
LEIEGIGRKKLDKMISSHMEGRQLKSIITAFSPYGISPAYCMKIYKKYADKSIDMVMNNP
YGLCKDVKGIGFKKADEIAKKLNAGLDSLERIEEGIKYLLQEAAYSGHTYMLMPQLVSKA
KELLSIDEEEILSCLNQMAINGGITIEEVDIEQRIYLDSYNLAETRAASNLIKLAYMNEL
ENQEKTIEQLELEEDIELSELQKKAVTMALENKMMILTGGPGTGKTTTLSFIIKSFEQMK
RKIILCAPTGRAAKRMSQATLRPASTIHRLLEAVYSEEADGLIFQKDEDDPIAADVIIVD
EVSMMDVMLLDSLLLAVSENTAVIFVGDKDQLPSVGAGRVLQDMLESNTIPSIELTEVFR
QAKQSMIIVNAHKINKGELPITDQKNTDFFFMAKKTPSQIAELIVELVSDRLPKYYKLSS
NNIQVLSPMRKSEAGVLNLNLLLQEALNPARQGKREHKAGNRTFRTGDRVMHIKNNYEKT
WENLEENISGEGIFNGDLGYIDFIEPSEKKLYIQFDDGKRAEYDFTELDQIEHAFATTVH
KSQGSEFDCVVMPVSAFPPMLMSRKILYTALTRAKKLAILVGDAKYLKAMISNVYEEKRN
TALSDKLKLYKETGMLLEENNGATVPF
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgcctatagaattaaaaggaaaaatttcagatataatatttcaaaacgatgaaaatggc
tacactatagcaaacctaatcagcgatgaacttggagaagttacagtggtgggctgtatg
ccatctgtcagagagctcgacaatatacaggtcagtggagagtggaagactcacgatata
tatggcagacagtttagtgttatgagcttcactcatatggctatagattcgctagatgga
atcatagcctacctagcatctggaacgatagaaggcataggtcttaaaatggcacataaa
atcacagataaattcgggataaaagctatagaaatcctagaaactaatcctaatagatat
ttagaaatagaaggcataggcagaaaaaagctcgataaaatgataagctctcatatggaa
ggaagacagctaaaatccataataacagcattttcgccatatggaataagcccagcctac
tgcatgaaaatctataaaaaatatgcagataaatccatagatatggtcatgaacaatccc
tacggtctatgtaaggatgtaaaagggatagggtttaaaaaagctgatgaaatagcaaaa
aaattaaatgctggacttgattctttagaaagaatagaagaaggcattaaatacctgctt
caagaagctgcatatagtggacatacatatatgctaatgcctcagctagtatcaaaagcc
aaggaactgctatcaatagatgaagaagaaattctatcttgcttgaatcagatggctata
aatggaggcataaccatagaagaagtagatatagagcaaagaatctatttggattcctat
aacctagcagagacaagagcagctagcaacctaataaagctggcatatatgaacgagctt
gaaaatcaagaaaaaaccatagagcaattagagctagaagaagatatagagctgtcagag
ctacaaaaaaaagctgtgactatggcacttgaaaacaaaatgatgatattaactggtggc
ccaggaactggaaaaacgactactcttagctttataatcaaaagctttgaacagatgaag
agaaaaattatcctctgcgcaccgacaggaagagcagcgaagcgtatgtcgcaggcaacc
ttgagaccagcctctacgattcatagactactagaggcagtatatagtgaagaagcagat
ggtcttatatttcaaaaagacgaagacgaccctatagccgctgatgtaataatagtagat
gaggtttctatgatggacgtgatgctcctagatagcttgcttcttgccgtatcagagaac
acggcggttatatttgtaggagacaaagaccagcttccatcagtaggagctggaagagtc
ctacaggatatgctagagagcaataccatacctagtatagagcttacagaagtatttaga
caggcaaagcaaagcatgataatagtcaatgcccacaaaataaataaaggtgagcttccg
atcacagaccaaaaaaatacagacttcttttttatggcaaagaaaactccgtctcagata
gcagagctaatagtagagctagtttcagatagactgccaaagtactataaactatcatca
aataatattcaggtactgtcacctatgagaaaatcagaagctggagtacttaatctaaac
ctcttactacaagaagcactcaatccagcaagacaaggcaaaagagagcataaagcggga
aatagaacttttagaacgggcgatagggtaatgcacataaaaaataactatgaaaaaacc
tgggaaaacttagaagaaaatatttctggagaaggaatatttaacggcgatttaggatat
atagacttcatagagcctagtgaaaaaaaactctatattcagtttgacgatggtaaaaga
gcggaatatgactttacagagctagatcagatagagcatgcatttgctactactgttcat
aaaagccaaggctctgagtttgattgcgtagtcatgccagtatcagcttttcctcctatg
ctcatgagcagaaagattctctacacagcacttacaagagcaaaaaaactagcaatacta
gtaggtgacgcaaaatacctaaaggctatgatatccaatgtctacgaggaaaagagaaat
accgccctatctgataagttaaaactttacaaagaaactggtatgctactggaggagaat
aatggagctactgtacccttctaa

DBGET integrated database retrieval system