KEGG   Clostridium sticklandii: CLOST_2394Help
Entry
CLOST_2394        CDS       T01334                                 

Gene name
thrC
Definition
(RefSeq) ThrC (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cst  Clostridium sticklandii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cst00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CLOST_2394 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLOST_2394 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CLOST_2394 (thrC)
Enzymes [BR:cst01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CLOST_2394 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2527505..2528566
Genome map
AA seq 353 aa AA seqDB search
MYKGLIDNYREFFNFNKETVPVTLNEGRTPLIRANNLETLLGIDIELYFKFEGLNPTGSF
KDRGMTSAVTKAVEDNSKAVICASTGNTSASAAAYAARAGLRSYVIIPDGKIAKGKLAQA
VAYGATILAIDGNFDVALDMVKEISSNHPITMVNSLNPHRIEGQKTAAFELCDDLKVAPD
YLFIPVGNAGNITAYWKGFNEYHKAGKISNLPQLMGFQAYNSAPLVLGHPVSNPETVATA
IRIGNPASGDRALAAIKESNGNIDRIKDEDILKAQFLLSTSEGIFAEPASCISLAGLIKA
KDEGRVNQGSKVVCVLTGNGLKDSDIILDNPYEYATLKSDYKVIEDYILRGNK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtataagggcttaattgataactacagagaattttttaattttaataaagaaacggtt
cctgtgacattaaatgaaggcaggacgccactgattcgagcaaataatctagaaaccctt
ctaggtatagatatagagctttattttaaattcgaaggacttaatcctacgggctccttt
aaagaccgtggtatgacaagtgcagttacaaaagctgtagaagataatagcaaggctgta
atttgtgcttcaactggaaatacatctgcatcagctgcagcctatgctgctagagcaggc
cttagatcctatgtcattatcccagatggaaaaatagctaaaggcaagctggctcaggct
gtagcctacggcgctactatacttgcaatagatggaaattttgatgtggcgctagatatg
gttaaggaaatttcaagcaatcatcctataactatggtaaattcacttaatcctcatcgt
atagaaggtcaaaaaactgctgcctttgaactatgcgatgatttaaaagtagctccagat
tatttatttattccagttggaaatgcaggtaatatcactgcttactggaagggctttaat
gaatatcataaagctggaaaaatttcgaatctgcctcagcttatgggctttcaagcatat
aacagtgctccactagtgcttggtcatccagtttcaaatccagaaactgttgctacagct
ataagaataggtaatccagcaagtggtgatagagctcttgccgctataaaagagtccaac
ggaaatatagatagaattaaggatgaggatattttaaaagcgcagtttttactttctaca
tcagaaggaatatttgctgagccagcttcatgtatatctctagctggtcttattaaagct
aaagatgagggccgtgtaaaccaaggctcaaaagtagtctgcgtattaactggaaatggt
ctaaaggacagtgacatcatactagacaacccttatgaatacgccaccttaaaatctgat
tacaaggtaatcgaggattatattttaagggggaataaataa

DBGET integrated database retrieval system