KEGG   Candidatus Caldiarchaeum subterraneum: CSUB_C1035Help
Entry
CSUB_C1035        CDS       T02904                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
csu  Candidatus Caldiarchaeum subterraneum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:csu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CSUB_C1035
Enzymes [BR:csu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CSUB_C1035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1002882..1003844
Genome map
AA seq 320 aa AA seqDB search
MSSFEVVVVGSLHMDLIVKLARIPAKGETVIGGSFQLSPGGKGANQAVAAARLGASVAIV
GRVGSDLFGDLLLERLRKENVATDYVVKDVETHSGVALIMVDKDGNNLIAVASGADARCS
PSDVDAAENVIASSKAILTQLEIPLAAVERGVAIARRHEVPVILNAAPAQRLPRRLLEMV
DVVVANRIEASVLTGVRVNDVVSAVRAGKRLLAMGVKYAVVTLGRRGAVTVDRKETVYLR
GVKVKAVDATGAGDAFCGALAFGLVRGIKIHDAAELANNAAALATTKLGAQEAMPTLAEL
HKFMASNGRAKNLESLFTIK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcatttgaggtagttgtggtgggcagtcttcacatggacctgatagtgaagctg
gccagaataccggctaagggagaaactgtgataggtggcagcttccagctttcgccggga
ggaaaaggagctaaccaagcggtggctgcggcgaggctcggggccagcgtagctattgtg
ggccgggtggggtctgaccttttcggtgaccttttgctggaaaggttgcggaaggaaaat
gttgcgacagattatgttgtcaaagatgtggagactcattcgggtgtcgctttgataatg
gtggacaaagatgggaacaacctcatagccgtggcgtctggagctgatgcgagatgctcg
ccgagcgacgtggacgccgcagagaatgtgatagcgtcttcaaaagcgattcttacgcag
cttgagatacctctagcggcggttgagcgaggtgttgcgatagcacgtagacacgaggtt
ccggtgatacttaacgcagcccctgcacagcgtctgccacgcaggttgctggagatggtt
gatgtggtggtcgcgaacaggattgaggcttctgtgttgaccggtgtgcgtgtgaatgat
gtggtgtcggcggtgcgtgcggggaagcggctgttggcgatgggtgtgaaatatgctgtt
gttacgcttgggaggagaggtgctgtgacggttgatagaaaagagacggtgtatctcagg
ggtgtgaaggtgaaggccgtggatgcgaccggtgcgggcgacgcgttctgcggggcccta
gccttcggcctcgtcagaggaataaagattcacgacgctgcggagctggccaacaacgcc
gccgcgctcgccacaaccaagctgggagcacaggaagccatgccaaccctcgcagaactc
cacaaattcatggcatcaaacggcagagcaaaaaacctcgaatcactgttcactatcaag
tag

DBGET integrated database retrieval system