KEGG   Candidatus Caldiarchaeum subterraneum: CSUB_C1058Help
Entry
CSUB_C1058        CDS       T02904                                 

Definition
4-aminobutyrate aminotransferase (EC:2.6.1.22)
Orthology
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
csu  Candidatus Caldiarchaeum subterraneum
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CSUB_C1058
   00650 Butanoate metabolism
    CSUB_C1058
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CSUB_C1058
   00280 Valine, leucine and isoleucine degradation
    CSUB_C1058
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CSUB_C1058
Enzymes [BR:csu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CSUB_C1058
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     CSUB_C1058
Amino acid related enzymes [BR:csu01007]
 Aminotransferase (transaminase)
  Class III
   CSUB_C1058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1028300..1029601)
Genome map
AA seq 433 aa AA seqDB search
MDRFLELRRLVSPGVALVHPITITRGENALLIDSEGNHYIDFTSGIGVINLGHGNTEIGE
AVEKALKNLWHLCFMVANYPGYVEVVEKLVETVPGDFEKRGVLFNSGAEAVENAVKIARH
VTKRPYAVSFENSFHGRTYLAMALTGKYEPYKVDFEPFPPAVEHAPFPYCYRCPFGQSYP
GCGLECMDYIKKHFFKTRVPPHKIACFIIEPIQGEGGFVPAPPEYLRELRSVCDEHGIVF
IDDEVQTGFCRTGRFYAIEHSGVAPDLVTVGKALANGLPLSAVAGKASLMDKMPPGSLGS
TFGGNPVACAAAVKVFEIMKRDNMAARAMRLGELMARRLGEFFERFELVGDVRGLGVMRA
FELVKDRRSKEPAVKETSMVLEHARRRGLLLLKAGLYSNVVRLHPPLTIQEELLEKGLDM
VEECLKEVSKQPS
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggataggtttctggagcttaggcggctggtttcacctggggtcgcgcttgttcatccg
ataaccattacgcgaggggagaacgccctgctcatcgactccgagggcaaccactacatc
gacttcacctcgggaataggtgtgattaaccttggacacggtaacactgagataggtgaa
gcggttgagaaagcgttgaagaatttatggcatctctgtttcatggtggccaattatccg
ggctatgtggaggttgttgagaagcttgtcgaaactgttcccggagattttgagaagcgt
ggtgtcttgtttaacagcggcgccgaggctgttgaaaacgctgtaaaaatagcccgccac
gtaaccaagagaccgtacgccgtctccttcgagaattctttccacggccgcacatatctc
gccatggctttgacgggcaagtatgagccctacaaggttgatttcgagccttttccaccc
gccgttgagcatgcgccatttccctactgctatcgctgcccgtttggacagagctacccc
ggctgcggcctcgaatgcatggactacatcaaaaaacatttcttcaagacaagggttcca
ccacataagatagcctgtttcatcatcgagcctattcagggcgagggcgggtttgtgcca
gctccgccagagtatctgagagagctgcgcagcgtttgcgacgagcatggcatagtgttt
attgatgacgaggttcagacaggtttttgcagaacaggccgcttttacgcgattgagcac
agcggtgtggcgcccgacctcgtgaccgtggggaaagcacttgccaacggcctccccttg
tcagcggttgctggaaaagcttcgctgatggataaaatgccgcctggctcgctggggtca
accttcggaggcaaccctgtcgcatgcgcggccgctgtgaaggtcttcgagattatgaaa
cgtgacaacatggctgctagggctatgcgtctcggtgagttgatggctaggaggcttggg
gagttttttgagaggtttgagctggtgggtgatgtgaggggccttggtgtgatgagggct
tttgagctggtgaaagataggaggagcaaggagcccgccgtaaaggagacatctatggtg
cttgagcatgcgcgccgccgtggcctccttctgctcaaagcagggctatactcaaacgtg
gtgaggcttcatccaccgttgaccatacaagaggagctgctggaaaaaggcctcgacatg
gttgaagaatgtctgaaagaggtttctaagcagccaagctaa

DBGET integrated database retrieval system