KEGG   Candidatus Caldiarchaeum subterraneum: CSUB_C1219Help
Entry
CSUB_C1219        CDS       T02904                                 

Definition
elongator complex protein 3 (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
csu  Candidatus Caldiarchaeum subterraneum
Brite
Enzymes [BR:csu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CSUB_C1219
Transfer RNA biogenesis [BR:csu03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    CSUB_C1219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1186936..1188435)
Genome map
AA seq 499 aa AA seqDB search
MTANAAQLTRREVERLKKQLAISLKLEKYPSDDELAQLLKSNITRKPAKTLSGVSVITIV
APLYTCPHGKCIYCPGGAPLGTPQSYTGEEAAVKTAAQLGYDPRKQVEAAVNRLRHMGHR
VDKVELIIIGGTFTASPPEFQRWMIKECVDALNGVASSSLEEALRINTSSAIHVSGITVE
TKPDWAKREKAVQLVEYGVTRVEIGVQALDDKILTTLNRGHSVEDVVEATADLKDTAFKV
CYHIMPNLPGSTPHKDLNMFTTLFDDDRFRPDQLKIYPTLVLPGTGLETMWRHGLYKPYS
DDELVYVLKEFMKRVPPYVRIARIQREIPLNIVLDGLHIPNLRQMVEKELGGMCRCIRCR
EHGHRNRPVDVRRAVLKRLVYRASGGLEYFVSVEDEEADALLGFVRVRIPPRTLRTELED
AGLVRELHVYGSMKAVGAPADETTSQHRGIGKQLMQEAENIVYEEHGLSRVAVISGAGVR
GYYARLGYRLEGPYMVKDR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgcaaacgcggcgcagctcacaaggcgggaagtggagcggctgaaaaaacaacta
gcgataagcctcaagcttgagaagtatccatcagacgatgagttagcccagctgctcaag
tcaaacattacacgcaaacccgccaaaaccctcagcggcgtatcggtcataacgattgtt
gcaccactctacacatgtccacatggaaaatgcatctactgccccggaggagctcctctg
ggaacacctcaaagctacaccggtgaagaagccgctgtcaagacagcggctcagctggga
tatgacccgagaaaacaggttgaagcagctgttaacagactcaggcacatgggccaccgt
gtggataaggtggagctaataataatcgggggcacgttcacagcaagtccgccggagttt
cagcgatggatgataaaggagtgtgttgacgccttgaacggcgttgcgagcagcagtctc
gaggaggcgctgcgcatcaacacatcctccgctatacatgtctcgggaataactgtggag
acgaagcctgactgggctaagagagagaaggctgtgcaactggttgagtatggtgtaaca
agggttgagataggtgtccaagccctcgacgacaaaattctcactacactgaacagggga
catagtgtggaagacgtggttgaggcgaccgccgacctcaaggacacggctttcaaggta
tgctaccacataatgcctaatctccccggctcaacacctcacaaagacctaaacatgttc
accacactcttcgacgacgaccgattcagaccagaccagctgaaaatctatccaacactc
gttctccccggcacaggtcttgagacgatgtggcgacacggcctctacaaaccctactcc
gacgatgagctcgtctatgtcttgaaagaattcatgaagagagtgccaccctatgtgagg
atagcgcggatacagcgggaaatcccgctcaacatagttctcgacggcctccatatcccg
aacctccgccaaatggttgagaaagaattgggcggtatgtgtcgatgcatacggtgcaga
gaacatggacacaggaaccggcctgtcgacgtgaggagagctgttttgaaacggctggtt
taccgtgcttcaggcgggttggagtattttgtctcggtcgaggatgaggaggctgacgct
cttctcgggtttgtgagggtacgaatacctccaagaaccctgaggactgagctggaggac
gctggactggttagggagcttcatgtatacggctcgatgaaagccgtcggagcacctgcc
gatgaaacaacctcccaacacagaggcataggaaagcagcttatgcaagaagcggaaaac
atagtctacgaggagcacgggctcagcagagtggctgtaatcagcggagccggcgttaga
ggatactatgctaggcttggatatcgtctcgaggggccctacatggtcaaagaccggtga

DBGET integrated database retrieval system