KEGG   Candidatus Caldiarchaeum subterraneum: CSUB_C1706Help
Entry
CSUB_C1706        CDS       T02904                                 

Definition
phosphoenolpyruvate carboxylase (EC:4.1.1.31)
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
csu  Candidatus Caldiarchaeum subterraneum
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:csu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CSUB_C1706
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CSUB_C1706
  Energy metabolism
   00680 Methane metabolism
    CSUB_C1706
Enzymes [BR:csu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CSUB_C1706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1630079..1631647)
Genome map
AA seq 522 aa AA seqDB search
MVNEERHIPRTMSSQHPDNVSSPPWLDTPLIEGDDEVEEVYQSWVTLGCEEAMWDAEGKD
VDLNVVRKLLTTHPEYFREKIIGRDHFLTYRIPNPSMEKSDRKVFFETLQSIPKHFDACE
AFYGRQVNPPVFEVILPFTTSVNQLIRVVNTYRKAVVQLEEIVIDYPNITLGDIIGKISP
EKIEVIPLFEDLDSMLNADTILGRFIELTSPRYVRAFIARSDPALNNGLVAATLMAKLAI
DKLQNLSTNTGIPVHTIIGVGTLPFRGGLSPTHLEKFYEEYGGVSTVTIQSAFRYDYPQN
IVKEAIKSINNTLPIEKRSTIIESVETVLKVIAKGSQAYRAFAEVAAPSIARVSALTPAR
RRRKLHVGAFAYSRVLGGVELPRAIPYACSFYTLGLPPEFIGLRFLYQLSEEEFDVLKEF
YNLAEDLRRVAPLVCFDNINTLLSEESKDKHELQPLREALPLYVEDLEAAQDLLNIKPGP
KTSSERKYSNILNNFLIAYMEENLEEARLELLRAAGIRRCLG
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggttaacgaagagagacacattccgaggacgatgagttcgcagcatcccgacaacgtc
tccagcccgccgtggctagatacgccgctgatagagggtgatgacgaggttgaagaggtt
taccagagctgggtcacattgggatgcgaggaagcgatgtgggacgccgaagggaaagac
gtcgacctcaacgtcgtccgcaaactgctcacaacacatcccgaatatttccgcgaaaaa
ataatcgggagagaccatttcctcacataccgcatacccaacccatcgatggagaaaagc
gacaggaaagttttcttcgaaacactgcaaagcatacccaagcatttcgacgcatgcgag
gcattctacggccgccaggtgaacccgcccgtcttcgaagtcatcctccccttcaccaca
tcagtaaaccaactcatacgtgtggtcaacacctatagaaaagcggttgtccagctggag
gaaatagtcatcgactatccaaacatcacgctaggagacatcatcggaaaaatcagccca
gaaaaaatcgaggtcatcccacttttcgaagacctagactcgatgctcaacgccgacact
atactgggaaggttcatagagctgacctcgccgcgttatgtgcgagccttcatcgcccgc
tcagacccggcgctcaacaacggcctcgtcgcagccacgttgatggccaaactagccata
gacaagctgcaaaacctatccacaaacacaggcatacctgttcacacaatcataggcgtt
ggaacacttcctttcagaggcggactcagcccaacacatctagaaaaattctacgaagaa
tacggcggcgtatccacggtaaccatacagtccgccttccgctacgattatccacaaaac
attgtgaaggaagctataaagagcatcaacaatacattacccatcgaaaaacggtcaacg
ataattgagagtgttgaaacggttttaaaggttatcgccaaaggttcccaggcttatagg
gctttcgccgaggtggctgcaccatccatagcccgtgtctcggcgctgacgcctgcgagg
cggagacgcaagctacatgtcggtgctttcgcctactcgcgtgtgcttggaggggttgag
ctgccgagagccatcccatatgcatgctccttttacacactcggcctgcctcccgagttt
ataggcctccgcttcctctaccaactatctgaagaggaatttgatgtgttgaaggagttc
tacaatcttgccgaagatttgcgcagagtcgctccgctggtttgcttcgacaacatcaac
acgctgctgagcgaggaatccaaagataagcatgaactgcagccccttagagaagctttg
ccactctacgtcgaggacctcgaagccgcacaagatctcctaaacataaagccggggccc
aaaacatcttcggagagaaaatacagcaacatactcaacaatttcctcatagcatatatg
gaggaaaatttggaggaggcgcgtctggagctgcttagagcagccgggattagaagatgc
ctaggctaa

DBGET integrated database retrieval system