KEGG   Cucumis sativus (cucumber): 101202796Help
Entry
101202796         CDS       T02486                                 

Gene name
TIPK
Definition
mitogen-activated protein kinase 3-like
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
csv  Cucumis sativus (cucumber)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 370 aa AA seqDB search
MADVGQNNPADFPALPTHGGQYVQYNIFGNPFEITSKYRPPIMPIGRGAYGIVCSVLNSE
TNEMVAVKKIANAFDNHMDAKRTLREIKLLRHLDHENVIGIRDVIPPPLRREFNDVYIST
ELMDTDLHQIIRSNQSLSEEHCQYFLYQILRGLKYIHSANVIHRDLKPSNLLLNANCDLK
ICDFGLARPTSENECMTEYVVTRWYRAPELLLNSDYTAAIDIWSVGCIFLELMNRRPLFP
GRDHVHQMRLLTELLGTPSESDLGFIRNEDSKRYLRQLPPHPRQPLATVFPHVHPLAIDL
VDKMLTFDPTKRITVEEALAHPYLERLHDIADEPVCSEPFSFEFEQQYLDEEQMKEMIYR
EALALNPEFA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgttggtcagaacaaccccgctgattttccagctctcccaacccatggtggc
caatacgttcagtataacatttttgggaatcccttcgaaatcacctccaaatatcgtcct
ccgattatgcctattggtcgcggcgcatacggaatcgtttgttctgttttgaattcggag
accaacgaaatggttgcggttaagaagattgctaacgcgtttgataaccatatggatgcg
aagagaacgctccgtgagattaagcttctacgccatttggatcatgaaaatgtaataggc
ataagagatgtgattcctccacctttacggagagaattcaatgatgtctacatttcgact
gaactaatggatactgatcttcaccaaataatccgctccaaccaaagtttatcagaagag
cattgtcagtatttcctttatcagattctcagaggactgaaatacatacattcggcaaat
gtcattcatcgagacttgaaaccgagcaatctattgcttaatgcaaactgtgatcttaaa
atatgtgactttggtcttgctcgaccaacttctgaaaatgaatgcatgacggaatatgtt
gtgacaagatggtacagagcacctgagcttcttttgaactctgattatacagctgcaatc
gatatatggtctgttggttgcatctttctggagcttatgaatagaaggcctttatttcca
ggcagggatcatgtgcatcagatgagattattgactgagctccttggcacaccaagcgag
tcagatcttggttttattcgaaatgaagactcgaaaagatatcttcgacaactacctcca
catcctcgtcagccattagcaacggtttttccacatgttcatccattagcaattgatctt
gtggataaaatgttgacatttgacccaacaaagagaattactgttgaagaagcgttagca
catccgtacctagaaagattgcatgacatagctgatgagccggtttgctcagagccattc
tcgtttgagtttgagcaacaatacttagacgaagaacagatgaaggagatgatttacaga
gaggcattggcactcaatccagaatttgcatga

DBGET integrated database retrieval system