KEGG   Cucumis sativus (cucumber): 101202796Help
Entry
101202796         CDS       T02486                                 

Gene name
TIPK
Definition
(RefSeq) mitogen-activated protein kinase 3-like
  KO
K20536  mitogen-activated protein kinase 3 [EC:2.7.11.24]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv04016  MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:csv00001]
 Environmental Information Processing
  Signal transduction
   04016 MAPK signaling pathway - plant
    101202796 (TIPK)
Enzymes [BR:csv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101202796 (TIPK)
Protein kinases [BR:csv01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101202796 (TIPK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Haspin_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 101202796
NCBI-ProteinID: NP_001267653
UniProt: Q0R4I2
Position
1
AA seq 370 aa AA seqDB search
MADVGQNNPADFPALPTHGGQYVQYNIFGNPFEITSKYRPPIMPIGRGAYGIVCSVLNSE
TNEMVAVKKIANAFDNHMDAKRTLREIKLLRHLDHENVIGIRDVIPPPLRREFNDVYIST
ELMDTDLHQIIRSNQSLSEEHCQYFLYQILRGLKYIHSANVIHRDLKPSNLLLNANCDLK
ICDFGLARPTSENECMTEYVVTRWYRAPELLLNSDYTAAIDIWSVGCIFLELMNRRPLFP
GRDHVHQMRLLTELLGTPSESDLGFIRNEDSKRYLRQLPPHPRQPLATVFPHVHPLAIDL
VDKMLTFDPTKRITVEEALAHPYLERLHDIADEPVCSEPFSFEFEQQYLDEEQMKEMIYR
EALALNPEFA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgttggtcagaacaaccccgctgattttccagctctcccaacccatggtggc
caatacgttcagtataacatttttgggaatcccttcgaaatcacctccaaatatcgtcct
ccgattatgcctattggtcgcggcgcatacggaatcgtttgttctgttttgaattcggag
accaacgaaatggttgcggttaagaagattgctaacgcgtttgataaccatatggatgcg
aagagaacgctccgtgagattaagcttctacgccatttggatcatgaaaatgtaataggc
ataagagatgtgattcctccacctttacggagagaattcaatgatgtctacatttcgact
gaactaatggatactgatcttcaccaaataatccgctccaaccaaagtttatcagaagag
cattgtcagtatttcctttatcagattctcagaggactgaaatacatacattcggcaaat
gtcattcatcgagacttgaaaccgagcaatctattgcttaatgcaaactgtgatcttaaa
atatgtgactttggtcttgctcgaccaacttctgaaaatgaatgcatgacggaatatgtt
gtgacaagatggtacagagcacctgagcttcttttgaactctgattatacagctgcaatc
gatatatggtctgttggttgcatctttctggagcttatgaatagaaggcctttatttcca
ggcagggatcatgtgcatcagatgagattattgactgagctccttggcacaccaagcgag
tcagatcttggttttattcgaaatgaagactcgaaaagatatcttcgacaactacctcca
catcctcgtcagccattagcaacggtttttccacatgttcatccattagcaattgatctt
gtggataaaatgttgacatttgacccaacaaagagaattactgttgaagaagcgttagca
catccgtacctagaaagattgcatgacatagctgatgagccggtttgctcagagccattc
tcgtttgagtttgagcaacaatacttagacgaagaacagatgaaggagatgatttacaga
gaggcattggcactcaatccagaatttgcatga

DBGET integrated database retrieval system