KEGG   Cucumis sativus (cucumber): 101202977Help
Entry
101202977         CDS       T02486                                 

Definition
(RefSeq) putative pectinesterase/pectinesterase inhibitor 22
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00040  Pentose and glucuronate interconversions
csv01100  Metabolic pathways
Module
csv_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101202977
Enzymes [BR:csv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     101202977
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pectinesterase PMEI Pectate_lyase_3
Motif
Other DBs
NCBI-GeneID: 101202977
NCBI-ProteinID: XP_004135600
UniProt: A0A0A0LWC9
Position
1
AA seq 543 aa AA seqDB search
MSRVSLAIHIFMLIFLPVLQVSCFDVNVIYPDEQNNVTQSMISQICADIEDRNSCISNIQ
LEMGRSVNSNPNSVLSAAIRATINEARRAIESITKFSTFSFSYREEMAIEDCKELLDFSV
AELAWSLAEMKRIRAGKNEAPDEGNLKAWLSAALSNQDTCLEGFEGTDRHIVGFIRGSLK
QVTLLISNVLALYTQLHSLPFQPPRNETMEKTKSSEFPDWMMDSEHKIVKSHPRNVHVDA
IVALDGSGDFRSITEAVNEAPSYSNRRYIIYVKKGVYKENIDMKRKKTNIMFIGDGIGET
IVTGSRNFLQGWTTFRTATVAVSGKGFIARDMTFRNTAGPENHQAVALRVDSDQSAFFRC
SFEGHQDTLYVHSLRQFYRECNIYGTIDYIFGNGAAVFQKCNIYTRVPLPLQKVTITAQG
RKSPHQSTGFSIQDSFIYATQPTYLGRPWKLYSRTVFLNTYMSGLVQPRGWLEWYGNFAL
GTLWYGEYKNYGPGASLSGRVKWPGYHNIQDPTMARFFTSEHFIDGRTWLPKTGIKFTLG
LSN
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagagtttctttagccattcatatttttatgttgatctttttgcctgtgttacaa
gtttcctgctttgatgttaatgttatttacccagatgaacaaaataatgttacacagtcc
atgatttctcagatttgtgctgatatcgaagatcgaaattcatgcatttcaaacatacaa
cttgagatgggaagaagtgtgaactcgaatccaaattctgtcttgagtgctgcaattaga
gcaactattaatgaagctagacgagccatagagtctataacaaagttcagcacattctcg
tttagctaccgtgaagaaatggcaattgaggactgcaaggagcttcttgatttctctgtg
gcagagctggcatggtcattagctgagatgaaaaggattcgtgcaggcaaaaacgaagct
cccgacgaagggaatctaaaagcatggctaagcgccgctctcagcaaccaagacacatgc
cttgaaggctttgaaggcacagacaggcacattgtaggtttcattagaggtagtttgaag
caagttacactgctcattagcaatgtcttggcattgtacactcaattacacagcttacca
tttcaacccccacggaatgaaacgatggagaaaactaaaagttcggagtttccagattgg
atgatggatagcgagcacaagattgtgaaatctcatccacgtaacgtccacgttgatgca
atcgtggctttggatggaagcggagatttccgttctatcacagaagctgtaaatgaagct
ccaagttatagcaatagaaggtacatcatatatgtgaagaagggagtctacaaagaaaat
atcgacatgaagcgaaagaaaacgaacataatgtttattggagatggtatcggagaaaca
atagtgaccggaagtcgtaattttctgcagggatggactactttcagaactgcaactgtt
gctgtctctgggaagggattcatagcaagagatatgacatttcgcaacacggctggacca
gaaaaccatcaggcagtggcactccgtgtcgactctgatcagtcagccttcttccggtgc
agcttcgaaggtcatcaagacaccctttacgtccactccctccgccaattttacagggaa
tgcaacatatacggcaccatagactacattttcggcaacggggcagcagtattccaaaaa
tgcaacatctacaccagagttcctctcccactccagaaggtcacaatcaccgcacaaggt
cgaaaatctccacaccagagtacaggtttttcaatccaagacagctttatttatgcaact
caaccaacatatcttggaagaccatggaagctatattcaaggactgtcttcttgaacact
tacatgagtggtttggtacaacctagaggatggcttgagtggtatggcaattttgcttta
ggcacattgtggtatggagagtataaaaactatggacctggtgcatccctatcaggtcga
gtcaaatggcctgggtaccataatattcaagaccctaccatggctagattcttcacctcc
gagcacttcatcgacggtcgaacatggttgccaaagacgggtattaagttcacattggga
ttgagtaactaa

DBGET integrated database retrieval system