KEGG   Cucumis sativus (cucumber): 101202977Help
Entry
101202977         CDS       T02486                                 

Definition
putative pectinesterase/pectinesterase inhibitor 22-like
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:csv00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:csv00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 543 aa AA seqDB search
MSRVSLAIHIFMLIFLPVLQVSCFDVNVIYPDEQNNVTQSMISQICADIEDRNSCISNIQ
LEMGRSVNSNPNSVLSAAIRATINEARRAIESITKFSTFSFSYREEMAIEDCKELLDFSV
AELAWSLAEMKRIRAGKNEAPDEGNLKAWLSAALSNQDTCLEGFEGTDRHIVGFIRGSLK
QVTLLISNVLALYTQLHSLPFQPPRNETMEKTKSSEFPDWMMDSEHKIVKSHPRNVHVDA
IVALDGSGDFRSITEAVNEAPSYSNRRYIIYVKKGVYKENIDMKRKKTNIMFIGDGIGET
IVTGSRNFLQGWTTFRTATVAVSGKGFIARDMTFRNTAGPENHQAVALRVDSDQSAFFRC
SFEGHQDTLYVHSLRQFYRECNIYGTIDYIFGNGAAVFQKCNIYTRVPLPLQKVTITAQG
RKSPHQSTGFSIQDSFIYATQPTYLGRPWKLYSRTVFLNTYMSGLVQPRGWLEWYGNFAL
GTLWYGEYKNYGPGASLSGRVKWPGYHNIQDPTMARFFTSEHFIDGRTWLPKTGIKFTLG
LSN
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagagtttctttagccattcatatttttatgttgatctttttgcctgtgttacaa
gtttcctgctttgatgttaatgttatttacccagatgaacaaaataatgttacacagtcc
atgatttctcagatttgtgctgatatcgaagatcgaaattcatgcatttcaaacatacaa
cttgagatgggaagaagtgtgaactcgaatccaaattctgtcttgagtgctgcaattaga
gcaactattaatgaagctagacgagccatagagtctataacaaagttcagcacattctcg
tttagctaccgtgaagaaatggcaattgaggactgcaaggagcttcttgatttctctgtg
gcagagctggcatggtcattagctgagatgaaaaggattcgtgcaggcaaaaacgaagct
cccgacgaagggaatctaaaagcatggctaagcgccgctctcagcaaccaagacacatgc
cttgaaggctttgaaggcacagacaggcacattgtaggtttcattagaggtagtttgaag
caagttacactgctcattagcaatgtcttggcattgtacactcaattacacagcttacca
tttcaacccccacggaatgaaacgatggagaaaactaaaagttcggagtttccagattgg
atgatggatagcgagcacaagattgtgaaatctcatccacgtaacgtccacgttgatgca
atcgtggctttggatggaagcggagatttccgttctatcacagaagctgtaaatgaagct
ccaagttatagcaatagaaggtacatcatatatgtgaagaagggagtctacaaagaaaat
atcgacatgaagcgaaagaaaacgaacataatgtttattggagatggtatcggagaaaca
atagtgaccggaagtcgtaattttctgcagggatggactactttcagaactgcaactgtt
gctgtctctgggaagggattcatagcaagagatatgacatttcgcaacacggctggacca
gaaaaccatcaggcagtggcactccgtgtcgactctgatcagtcagccttcttccggtgc
agcttcgaaggtcatcaagacaccctttacgtccactccctccgccaattttacagggaa
tgcaacatatacggcaccatagactacattttcggcaacggggcagcagtattccaaaaa
tgcaacatctacaccagagttcctctcccactccagaaggtcacaatcaccgcacaaggt
cgaaaatctccacaccagagtacaggtttttcaatccaagacagctttatttatgcaact
caaccaacatatcttggaagaccatggaagctatattcaaggactgtcttcttgaacact
tacatgagtggtttggtacaacctagaggatggcttgagtggtatggcaattttgcttta
ggcacattgtggtatggagagtataaaaactatggacctggtgcatccctatcaggtcga
gtcaaatggcctgggtaccataatattcaagaccctaccatggctagattcttcacctcc
gagcacttcatcgacggtcgaacatggttgccaaagacgggtattaagttcacattggga
ttgagtaactaa

DBGET integrated database retrieval system