KEGG   Cucumis sativus (cucumber): 101202981Help
Entry
101202981         CDS       T02486                                 

Definition
probable protein disulfide-isomerase A6-like
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:csv04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 361 aa AA seqDB search
MAKHQIWFAVAALALFLSSAVADDVVVLTEDNFEKEVGQDKGALVEFYAPWCGHCKKLAP
EYEKLGGSFKKAKSVLIGKVDCDEHKGVCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAD
ALAEFVNSEGGTNVKIASIPSSVVVLSADNFDEVVLDSSKDVLVEFYAPWCGHCKNLAPI
YEKVATAFKLEEDVVIANLDADKYRDLAEKYGISGFPTLKFFPKGNKDGEDYDGGRDVDD
FVSFINEKSGTNRDAKGQLTVKAGLVASLESLVKEFVAASKEEKKSIFAKIEEEAGKLSG
SAARHGKIYVKSAKKCMEKGGDYAKSEIERIKRILEKSVSPAKADEFNLKRNILSSFVQS
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcatcagatctggttcgctgtcgccgcattggccttgtttctgtcttcggca
gtggccgacgatgtcgtagtgttgacggaggacaatttcgagaaagaagttggccaagat
aaaggagctctcgttgaattttacgctccatggtgtgggcactgtaagaagcttgcgcca
gagtatgaaaagcttggaggcagctttaagaaagcaaaatctgttttgatcggaaaggtc
gactgtgatgagcacaagggcgtatgtagcaaatatggtgtctctgggtacccaacgatc
caatggtttcccaagggatcacttgaaccgaaaaaatacgaaggtcagcgtacagcagat
gcccttgccgagtttgtgaacagtgaaggaggaacaaatgtgaagatagcatctattcca
tccagcgtggtagtgctttctgctgataacttcgatgaggtcgttttggattcaagcaaa
gatgtgctggttgagttttatgcaccctggtgtggccactgcaagaaccttgctcctatt
tatgaaaaggtggctacagcatttaaattggaagaagatgtagtaattgctaacttagat
gccgacaaatacagggatctagctgaaaagtatggcataagtggcttccctacgttaaaa
ttcttcccaaaaggcaacaaagatggtgaagactatgatggtggcagagatgttgatgac
tttgttagtttcattaacgaaaaaagtgggaccaatcgtgatgcaaagggacagcttaca
gtaaaagctggtttagttgctagtttagaatcattggtgaaagagtttgtagctgctagc
aaggaagagaaaaagagtatttttgccaagatagaagaagaagctggaaagcttagtgga
tcagctgcaaggcacggaaagatatacgtgaaatctgctaaaaaatgtatggagaaaggt
ggtgattatgccaagtctgagattgagaggatcaagcgtatactcgagaagtcggtgagc
ccagcaaaagcagacgaattcaacctaaagagaaacattctgtcaagttttgttcaatct
tcttaa

DBGET integrated database retrieval system