KEGG   Cucumis sativus (cucumber): 101202981Help
Entry
101202981         CDS       T02486                                 

Definition
probable protein disulfide-isomerase A6-like
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:csv00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101202981
Enzymes [BR:csv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101202981
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 361 aa AA seqDB search
MAKHQIWFAVAALALFLSSAVADDVVVLTEDNFEKEVGQDKGALVEFYAPWCGHCKKLAP
EYEKLGGSFKKAKSVLIGKVDCDEHKGVCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAD
ALAEFVNSEGGTNVKIASIPSSVVVLSADNFDEVVLDSSKDVLVEFYAPWCGHCKNLAPI
YEKVATAFKLEEDVVIANLDADKYRDLAEKYGISGFPTLKFFPKGNKDGEDYDGGRDVDD
FVSFINEKSGTNRDAKGQLTVKAGLVASLESLVKEFVAASKEEKKSIFAKIEEEAGKLSG
SAARHGKIYVKSAKKCMEKGGDYAKSEIERIKRILEKSVSPAKADEFNLKRNILSSFVQS
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcatcagatctggttcgctgtcgccgcattggccttgtttctgtcttcggca
gtggccgacgatgtcgtagtgttgacggaggacaatttcgagaaagaagttggccaagat
aaaggagctctcgttgaattttacgctccatggtgtgggcactgtaagaagcttgcgcca
gagtatgaaaagcttggaggcagctttaagaaagcaaaatctgttttgatcggaaaggtc
gactgtgatgagcacaagggcgtatgtagcaaatatggtgtctctgggtacccaacgatc
caatggtttcccaagggatcacttgaaccgaaaaaatacgaaggtcagcgtacagcagat
gcccttgccgagtttgtgaacagtgaaggaggaacaaatgtgaagatagcatctattcca
tccagcgtggtagtgctttctgctgataacttcgatgaggtcgttttggattcaagcaaa
gatgtgctggttgagttttatgcaccctggtgtggccactgcaagaaccttgctcctatt
tatgaaaaggtggctacagcatttaaattggaagaagatgtagtaattgctaacttagat
gccgacaaatacagggatctagctgaaaagtatggcataagtggcttccctacgttaaaa
ttcttcccaaaaggcaacaaagatggtgaagactatgatggtggcagagatgttgatgac
tttgttagtttcattaacgaaaaaagtgggaccaatcgtgatgcaaagggacagcttaca
gtaaaagctggtttagttgctagtttagaatcattggtgaaagagtttgtagctgctagc
aaggaagagaaaaagagtatttttgccaagatagaagaagaagctggaaagcttagtgga
tcagctgcaaggcacggaaagatatacgtgaaatctgctaaaaaatgtatggagaaaggt
ggtgattatgccaagtctgagattgagaggatcaagcgtatactcgagaagtcggtgagc
ccagcaaaagcagacgaattcaacctaaagagaaacattctgtcaagttttgttcaatct
tcttaa

DBGET integrated database retrieval system