KEGG   Cucumis sativus (cucumber): 101203414Help
Entry
101203414         CDS       T02486                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L3-like
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
csv  Cucumis sativus (cucumber)
Brite
Enzymes [BR:csv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101203414
Peptidases [BR:csv01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   101203414
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 242 aa AA seqDB search
MAAAIHETSSSAHKRWLPLEANPDVMNQFLWGLGLPEDEAECGDVYGLDDELLDMVPKPV
LAVLFLYPITEKSEEERRQQEKEAKKDYSNQVYFMKQTVGNACGTIGLLHAIGNVTSEIK
LSEGSFLDRFFKSTKSMDPIERAAFLEKDDEMEVAHSVAATAGDTTAPEKVDTHFICFSC
VDGKLYELDGRKTEPISHGPSSPNSLLQDAARVIKDMISDNPESLNFNVIAISKRTGPEG
SI
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgctattcacgaaacctcttcttcagctcataagcgatggcttccacttgaa
gctaaccctgatgttatgaaccagttcctttggggtctcggtcttcctgaagatgaagca
gagtgcggtgatgtttatggcttggatgatgagctcttggacatggtgcctaagcctgtt
ctggcggttttgtttctttatcccataaccgaaaagagcgaagaagagagacgacaacag
gaaaaggaagcaaagaaggattacagcaatcaagtatactttatgaaacaaacagttggc
aatgcctgtggaactattggactgcttcatgctattgggaacgttacttcggaaattaag
ctttcggagggatcattcttggataggttcttcaagtctaccaaaagcatggatccgatc
gagcgtgcggcatttcttgagaaagacgatgaaatggaagttgcacattcagtagcagca
actgctggagatacgacagctccggagaaagtcgatactcactttatctgcttctcatgt
gtggatgggaaactttatgagctcgacgggagaaagacggaacctatatcacatggtcca
tcatcacccaacagtttattacaggatgcagctcgagtcataaaagacatgatctcggat
aaccccgagtcgctgaacttcaatgtcattgccatctcaaagaggactgggccggaagga
agcatctga

  All links  
No link information was found.   
DBGET integrated database retrieval system