KEGG   Cucumis sativus (cucumber): 101203770Help
Entry
101203770         CDS       T02486                                 

Definition
(RefSeq) uroporphyrinogen-III synthase, chloroplastic
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00860  Porphyrin and chlorophyll metabolism
csv01100  Metabolic pathways
csv01110  Biosynthesis of secondary metabolites
Module
csv_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    101203770
Enzymes [BR:csv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     101203770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-GeneID: 101203770
NCBI-ProteinID: XP_004152728
UniProt: A0A0A0LLB2
Position
2
AA seq 311 aa AA seqDB search
MASVSLSSFSHPPSVVVPSPCLQFYGRILLPRRTLACSSSTSVSSSSITSSSSISAPKVV
VTRERGKNGKLVNALARHGINCLELPLIQHRQGPDLNRLHSVLSDSVFDWIVITSPEAGL
VFLEAWKAAGMPKVRIGVVGAGTANIFEEVLQSSKLLEVAFAPSKAIGKVLASELPKLGN
TKCSVLYPASTKASNDIEECLSNRGFEVTRLNTYTTAPVDYVDQTILEQARSLPVVTVAS
PSAVRAWVNLISDPKEWDKSLACIGETTAAAANRLGLKNVYYPKNPGLEGWVDSILEALR
SEAQVVGHFSE
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagtttctctctcttctttctctcatccgccttcagttgttgttccttcgcct
tgtctgcaattttacgggcgaatcttacttccccgtagaactcttgcttgttcctcctcc
acttcggtttcttcttcttcgatcacgtcttcttcgtcaatttcggcgccgaaagtagtg
gttaccagagagcgcggcaagaacgggaagctcgttaatgctctggcaagacatggaata
aactgtttggaacttcccctgattcaacacagacaaggacctgatttgaataggctacac
tctgtacttagtgattctgtatttgactggattgtcataacttcccctgaagctggcttg
gtgttcctagaggcatggaaggccgctggaatgccaaaagttagaataggtgtcgtggga
gctggtacagctaacatttttgaggaagtgttgcaatcatcaaaactacttgaagtggca
tttgcaccctcaaaagcaataggcaaggtcttggcttctgagcttccaaagttaggaaat
acaaagtgcagtgtcttgtatcctgcatctactaaggctagcaatgatattgaggaatgt
ctttcaaatcgtggatttgaggtcacaaggctcaacacctacaccacggcacctgttgat
tacgttgatcaaaccattctggagcaagcacgttcattgcctgttgtcaccgtggcttct
ccttcggcagttcgggcatgggtcaatcttatttcagatccaaaggagtgggataagtcg
cttgcatgtattggggaaacaaccgcagcagcagcaaatagattaggattgaaaaacgtt
tactaccccaagaatcctggcttggaagggtgggttgatagtatattggaagcactaaga
tcggaagctcaggttgttggtcatttttcagagtag

DBGET integrated database retrieval system