KEGG   Cucumis sativus (cucumber): 101203770Help
Entry
101203770         CDS       T02486                                 

Definition
uroporphyrinogen-III synthase, chloroplastic-like
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    101203770
Enzymes [BR:csv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     101203770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 311 aa AA seqDB search
MASVSLSSFSHPPSVVVPSPCLQFYGRILLPRRTLACSSSTSVSSSSITSSSSISAPKVV
VTRERGKNGKLVNALARHGINCLELPLIQHRQGPDLNRLHSVLSDSVFDWIVITSPEAGL
VFLEAWKAAGMPKVRIGVVGAGTANIFEEVLQSSKLLEVAFAPSKAIGKVLASELPKLGN
TKCSVLYPASTKASNDIEECLSNRGFEVTRLNTYTTAPVDYVDQTILEQARSLPVVTVAS
PSAVRAWVNLISDPKEWDKSLACIGETTAAAANRLGLKNVYYPKNPGLEGWVDSILEALR
SEAQVVGHFSE
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagtttctctctcttctttctctcatccgccttcagttgttgttccttcgcct
tgtctgcaattttacgggcgaatcttacttccccgtagaactcttgcttgttcctcctcc
acttcggtttcttcttcttcgatcacgtcttcttcgtcaatttcggcgccgaaagtagtg
gttaccagagagcgcggcaagaacgggaagctcgttaatgctctggcaagacatggaata
aactgtttggaacttcccctgattcaacacagacaaggacctgatttgaataggctacac
tctgtacttagtgattctgtatttgactggattgtcataacttcccctgaagctggcttg
gtgttcctagaggcatggaaggccgctggaatgccaaaagttagaataggtgtcgtggga
gctggtacagctaacatttttgaggaagtgttgcaatcatcaaaactacttgaagtggca
tttgcaccctcaaaagcaataggcaaggtcttggcttctgagcttccaaagttaggaaat
acaaagtgcagtgtcttgtatcctgcatctactaaggctagcaatgatattgaggaatgt
ctttcaaatcgtggatttgaggtcacaaggctcaacacctacaccacggcacctgttgat
tacgttgatcaaaccattctggagcaagcacgttcattgcctgttgtcaccgtggcttct
ccttcggcagttcgggcatgggtcaatcttatttcagatccaaaggagtgggataagtcg
cttgcatgtattggggaaacaaccgcagcagcagcaaatagattaggattgaaaaacgtt
tactaccccaagaatcctggcttggaagggtgggttgatagtatattggaagcactaaga
tcggaagctcaggttgttggtcatttttcagagtag

DBGET integrated database retrieval system