KEGG   Cucumis sativus (cucumber): 101204232Help
Entry
101204232         CDS       T02486                                 

Definition
(RefSeq) phosphoinositide phospholipase C 2-like
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00562  Inositol phosphate metabolism
csv01100  Metabolic pathways
csv04070  Phosphatidylinositol signaling system
csv04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101204232
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    101204232
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101204232
Enzymes [BR:csv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101204232
Membrane trafficking [BR:csv04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101204232
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101204232
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y C2 EF-hand_like
Motif
Other DBs
NCBI-GeneID: 101204232
NCBI-ProteinID: XP_004145317
UniProt: A0A0A0LXL9
Position
1
AA seq 554 aa AA seqDB search
MKHSFKVCFFFRRRFRANVSEAPEDVKMMFDEYSENGTMNIEQLQKFLKDVQGEGRKKAQ
AIFNNFKHLNFFQRRGLHLEEFFSYLLDQDLNHALSPSHGDNQDMTAPLSHYYIFTGHNS
YLTGNQLSSDSSETPIIRALKKGVRAIELDLWPNSKKDGIHVRHGGTLTAPVELNKCLKA
IKDHAFTASEYPVVITFEDHLTHDLRQDVAEMLNSTFRDILYVPKRGEDVHQFPSPELLK
GKILISTKPPERRTKEKPPADDQSANSQDDIDEEYLEMLDKDEDIAIPEYESLIAIRAKK
MKRGSDLQTFFNDVEKVSRVSLSERELVDVVSKYKHEIISFTQESLLRVYPKGLRVDSSN
YDPMLAWNHGAQMVAFNMQRNDKHLWIMEGMFRGNNGCGYIKKPEFLLNNPSNSRSLSAT
RINGLKIKVYMGEGWNLDFRRTHFDFYSPPDLYVKIKMVGVENDKARNKTIPIEDQWVPV
WNEEFSFSISTPELAFLQIIVRDYDTSGKDDFAGQTCLPVKDLRSGIRAVPLYNKRGERY
KHVKLLMGFELQFE
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacagttttaaagtctgcttctttttcagaagaagattcagggcaaatgtatct
gaagcaccagaagatgtgaagatgatgtttgatgaatactcagagaatggcacaatgaac
attgagcaattgcagaagtttttgaaagatgttcaaggagaaggtagaaaaaaagcccag
gccatcttcaacaatttcaagcacctcaatttctttcagagaagaggccttcatctagaa
gaattcttcagttatcttcttgatcaagaccttaatcatgctctctctccctcccatggg
gataatcaggacatgacagctccattgtctcactattacatatttactggccacaactcc
tacttaacaggaaatcaactcagtagtgactccagtgagactcctatcataagggctcta
aagaaaggagtaagagcaattgagcttgatttatggcctaattccaagaaagatggcatt
catgttcgtcatggagggacacttacagctcctgtggaactcaacaaatgcctaaaagca
attaaagatcatgcctttacagcttctgagtatcctgtagtgataacttttgaggaccat
ctcactcatgatcttcgacaagatgtggccgagatgcttaattcaacatttagggacatc
ctctatgttcctaaacgtggagaagacgttcatcaatttccatcgccagagttacttaag
ggaaagattctgatttctaccaaaccaccagagcgcagaaccaaggaaaaaccaccagca
gatgatcagagtgcaaattctcaagacgatatagatgaggagtatctggagatgttggat
aaagatgaagatattgctattccagaatatgaaagtttgattgctattcgtgcaaagaag
atgaaacgtggatcagatctccagaccttctttaatgatgtagaaaaagtttcgagagtt
agtctgagtgagcgagaacttgtagatgttgtgtcaaaatataaacacgaaattatcagc
tttactcaggagagtttgctgagagtgtatccaaaaggtttaagagtagactcatctaat
tacgatcctatgcttgcctggaatcatggagctcaaatggttgcttttaacatgcagaga
aatgacaaacacttgtggatcatggaaggaatgttcagaggcaataatggttgtggctac
attaagaaacctgaattcttgctgaataacccatctaattccagatccttatccgcgaca
aggataaatggtttaaagataaaggtatacatgggagaaggatggaatttggacttccgt
cgcacacatttcgatttctattcacctccagatttatacgttaagatcaaaatggtcggg
gttgaaaatgataaagcgaggaacaaaaccatccccattgaagaccagtgggtacctgtt
tggaatgaggagtttagtttctcaataagcactcctgaattggcttttctacaaataatt
gttcgtgattacgacacatctggaaaagatgacttcgcggggcagacatgtttgccggtg
aaagatctgcgatcaggaatccgagcagtgccattgtacaataagaggggagagagatac
aagcatgtgaagctccttatgggcttcgaactccaattcgaatag

DBGET integrated database retrieval system