KEGG   Cucumis sativus (cucumber): 101204301Help
Entry
101204301         CDS       T02486                                 

Definition
mitogen-activated protein kinase homolog MMK1-like
Orthology
K14512  
mitogen-activated protein kinase 6 [EC:2.7.11.24]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Plant hormone signal transduction
Class
Environmental Information Processing; Signal transduction; Plant hormone signal transduction [PATH:csv04075]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 405 aa AA seqDB search
MDDGGASQPDDTVMSEAASVPPPQHDPAAQQQHQHQPPSMGMENIPATLSHGGRFIQYNI
FGNIFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREI
KLLRHMDHENVVAIRDIIPPPLRETFNDVYIAYELMDTDLHQIIRSNQALSEEHCQYFLY
QILRGLKYIHSANVLHRDLKPSNLLLNANCDLKICDFGLARVTSETDFMTEYVVTRWYRA
PELLLNSSDYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLLELIGTPSEADLGFL
NENAKRYIRQLPHYHRQSFTEKFPHVHPAAIDLVEKMLTFDPGQRITVEDALAHPYLTSL
HDISDEPVCMTPFSFDFEQHALTEEQMKELIYLEALAFNPEYHHQ
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggacgacggaggagcttctcagccggacgacaccgtcatgtcggaggcggcgtctgta
cctccaccacagcatgacccggcggcgcaacagcaacatcagcatcagccgccgtcgatg
gggatggaaaatattccggcgactttgagccatggagggagatttattcagtataatata
tttggtaacatctttgaagttacggccaagtacaagcctcctattatgcctattggcaaa
ggcgcttacggcatcgtctgttctgctctcaactctgagacgaacgagcatgtggcgatt
aagaagattgctaatgcgtttgataacaagatcgatgctaagagaactcttcgtgagatc
aagcttcttcggcatatggatcatgaaaacgttgttgcgattagggatatcatacctcca
cctctaagggaaacatttaatgatgtttatatcgcatatgagctaatggataccgacctt
catcaaataattcgttcaaaccaagcattatcagaggagcattgtcagtatttcctgtac
cagatacttcgtggattgaagtacatacattcggctaatgttctgcacagagatttgaaa
ccttccaatctgctattaaatgcgaactgcgacctgaaaatatgcgatttcggacttgct
cgtgttacttctgaaactgacttcatgacagaatatgtggttactagatggtaccgtgca
ccagagctcttacttaattcatctgattacactgcagctattgatgtctggtctgttggt
tgtatttttatggaactaatggatcggaagcccttgtttcctggtcgagatcacgtgcat
cagttacgcttgcttttggagctgattggcactccatcagaggctgatcttggttttttg
aacgagaatgctaaaagatacatacggcaattacctcattaccatcgtcaatcattcacc
gaaaagtttccacatgtccatcctgcagccattgatctggtggagaagatgctaacattt
gatccaggacagagaattaccgttgaagacgctctagctcatccttatttgacttcatta
cacgacattagtgatgagcctgtctgcatgacacccttcagctttgatttcgagcagcat
gcgcttaccgaggaacagatgaaagagctgatctatctagaggcgcttgcatttaacccc
gagtatcatcaccaataa

DBGET integrated database retrieval system