KEGG   Cucumis sativus (cucumber): 101204301Help
Entry
101204301         CDS       T02486                                 

Definition
mitogen-activated protein kinase homolog MMK1-like
Orthology
K14512  
mitogen-activated protein kinase 6 [EC:2.7.11.24]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:csv00001]
 Environmental Information Processing
  Signal transduction
   04075 Plant hormone signal transduction
    101204301
Enzymes [BR:csv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101204301
Protein kinases [BR:csv01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   101204301
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 405 aa AA seqDB search
MDDGGASQPDDTVMSEAASVPPPQHDPAAQQQHQHQPPSMGMENIPATLSHGGRFIQYNI
FGNIFEVTAKYKPPIMPIGKGAYGIVCSALNSETNEHVAIKKIANAFDNKIDAKRTLREI
KLLRHMDHENVVAIRDIIPPPLRETFNDVYIAYELMDTDLHQIIRSNQALSEEHCQYFLY
QILRGLKYIHSANVLHRDLKPSNLLLNANCDLKICDFGLARVTSETDFMTEYVVTRWYRA
PELLLNSSDYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLLELIGTPSEADLGFL
NENAKRYIRQLPHYHRQSFTEKFPHVHPAAIDLVEKMLTFDPGQRITVEDALAHPYLTSL
HDISDEPVCMTPFSFDFEQHALTEEQMKELIYLEALAFNPEYHHQ
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggacgacggaggagcttctcagccggacgacaccgtcatgtcggaggcggcgtctgta
cctccaccacagcatgacccggcggcgcaacagcaacatcagcatcagccgccgtcgatg
gggatggaaaatattccggcgactttgagccatggagggagatttattcagtataatata
tttggtaacatctttgaagttacggccaagtacaagcctcctattatgcctattggcaaa
ggcgcttacggcatcgtctgttctgctctcaactctgagacgaacgagcatgtggcgatt
aagaagattgctaatgcgtttgataacaagatcgatgctaagagaactcttcgtgagatc
aagcttcttcggcatatggatcatgaaaacgttgttgcgattagggatatcatacctcca
cctctaagggaaacatttaatgatgtttatatcgcatatgagctaatggataccgacctt
catcaaataattcgttcaaaccaagcattatcagaggagcattgtcagtatttcctgtac
cagatacttcgtggattgaagtacatacattcggctaatgttctgcacagagatttgaaa
ccttccaatctgctattaaatgcgaactgcgacctgaaaatatgcgatttcggacttgct
cgtgttacttctgaaactgacttcatgacagaatatgtggttactagatggtaccgtgca
ccagagctcttacttaattcatctgattacactgcagctattgatgtctggtctgttggt
tgtatttttatggaactaatggatcggaagcccttgtttcctggtcgagatcacgtgcat
cagttacgcttgcttttggagctgattggcactccatcagaggctgatcttggttttttg
aacgagaatgctaaaagatacatacggcaattacctcattaccatcgtcaatcattcacc
gaaaagtttccacatgtccatcctgcagccattgatctggtggagaagatgctaacattt
gatccaggacagagaattaccgttgaagacgctctagctcatccttatttgacttcatta
cacgacattagtgatgagcctgtctgcatgacacccttcagctttgatttcgagcagcat
gcgcttaccgaggaacagatgaaagagctgatctatctagaggcgcttgcatttaacccc
gagtatcatcaccaataa

DBGET integrated database retrieval system