KEGG   Cucumis sativus (cucumber): 101204418Help
Entry
101204418         CDS       T02486                                 

Definition
phosphoinositide phospholipase C 4-like
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101204418
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    101204418
Enzymes [BR:csv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101204418
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 581 aa AA seqDB search
MGNYRVCLCFIRRFKMSKEEPPPDVKEAFVKYAGGVAANMTAEHLRSFLVEFQGDQTASL
ADAQRIVEHVLQRRHHVITKLTKHCLTLDDFYYYLFSMDLNPSISDQVHQDMRAPLSHYY
IYTSHNTYLTGNQLSSDSSDVPIINALKSGVRVVELDLWPNSEEDEIDVLHGRTLTTPVE
FVRCLKSIKENAFIASPYPVIITLEDHLTPDLQAKAAEYIKETFGDMLFFPEAEYLQEFP
SPEELKYRIIISTKPPKEYLKSKNVKGENSFSDDETDDEDGYLDGVYNFVGLQSESESSE
SDDSDYESYTTGVSEYKRLIAIHAGKPKGGLKEALKVGADKVRRLSLSEKALKKATKAHG
KDVIRFTQKNMLRIYPKGTRVNSSNYKPQNAWLHGAQMVAFNMQGHGKSLSLMRGMFRSN
GGCGYVKKPDFLLTVDAHGKVFDPTANLPVKRTLKVKVYMGVGWNLDFENTHFHLYSPPD
FYTKIGIAGAPADELIKKTEIKEETWSPVWNEEFTFPLTIPELALLRIDVYSYNISDKDV
FGGQNCLPVSEVKPGIHAVPLFDRKGSKYSSVKLLMRFEFS
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgggaaattacagagtttgtctctgtttcattagaaggtttaagatgtctaaagaagag
ccaccacctgacgtgaaggaggcgtttgtcaaatatgctggcggtgttgccgccaatatg
accgccgagcacctccgatcgtttctcgttgagtttcaaggagatcagacggcgtcactg
gccgatgctcaacggattgttgaacacgtgcttcagcgacgacatcacgtgatcaccaaa
ctcacgaaacattgtctcactcttgatgatttctattactatctcttctctatggatctg
aatccctcaatttcagatcaggttcatcaggatatgagagctccattgtctcattattat
atttacactagtcacaacacatacttgactgggaatcaattgagtagtgattctagtgat
gttccaattataaatgcactgaagagcggcgtgcgagttgtggagcttgatttgtggcca
aattctgaagaagatgaaatagatgttcttcatggaaggactttgacaacacctgtggaa
tttgttagatgtttgaaatctattaaagagaatgctttcatagcatctccatatcctgtc
ataattactctagaagatcaccttactcctgatcttcaagctaaagccgcagagtacata
aaggaaacatttggagatatgctgttctttcctgaagcagaatatctacaagaattccct
tctcctgaagaattgaagtatcggatcatcatttcaacaaaaccccctaaagaatacctc
aaatccaaaaatgtgaaaggggagaattctttcagtgatgatgagactgatgatgaagat
gggtatcttgatggagtatacaacttcgttgggttgcagagtgagagtgaatccagcgag
agtgatgacagtgattacgaatcttacactacaggtgtatcggaatacaaacgtcttatc
gccattcatgctggaaaaccgaaaggaggtttgaaggaagctctaaaagttggagctgac
aaagttagacgccttagcttgagtgaaaaggcactcaaaaaggcaactaaagctcatgga
aaggatgttattagattcactcagaaaaacatgttaaggatatatccaaagggaactcgg
gtaaactcgtccaactacaagccacaaaatgcttggttacatggggcccagatggttgct
ttcaatatgcagggacatggaaagtctctcagcttaatgcgtgggatgtttcgatctaac
ggaggttgtggttatgtgaaaaaacctgattttctactcacagttgatgcccatggcaag
gtgtttgatcctactgcaaatttgccagttaaaagaactttgaaggtgaaagtctacatg
ggtgttggctggaatttggattttgaaaacacccactttcatttatattctccacctgac
ttctacacaaagattggaattgcaggagccccagctgatgagctaataaagaaaacagag
atcaaagaagagacttggagccctgtttggaatgaagagttcacatttcctttgaccatt
cctgaattggctttacttcgaatcgacgtgtatagttacaacatatcagataaggatgtt
ttcggaggacaaaactgtcttcctgtttctgaagtgaagccaggcatccatgctgttcct
ctttttgaccgtaaaggatcgaagtacagttctgtaaagcttctaatgcgttttgagttt
tcctga

DBGET integrated database retrieval system