KEGG   Cucumis sativus (cucumber): 101204789Help
Entry
101204789         CDS       T02486                                 

Definition
endoglucanase 16-like
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:csv00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 492 aa AA seqDB search
MGVMNTNNVSTTPILLLVCCLVFLQSIVSLRVVKADLNYKDALTKSLIFLEAQRSGKLPP
NHRPAWRGDSALDDGQLANVDLVGGYYDAGDNVKYGLPMAFTITTLAWGALAYPEEIEAA
GEMENVKAALQWGTDYFLKAASRRNRLYVQVGDPVKDHECWVRPENMKTLRSVLQIDSNT
PGTEIAAETSAAMASASMVFRSSNQTYARRLLNKAKLLYQLAKNHKGTYDGECPFYCSYS
GFNDELLWAATWLYIATKRPVYLKYIQEESISASVAEFSWDLKYAGAQILLSKFFFEGEK
GLQMYKNQADSYICSNLPDSPFHQIYVSPGGMVHLRDGANTQYVAGTAFLFSAYSDLLAT
YKQTAQCADKSFDSTQLMMFAKKQMDYILGTNPQGRSYMVGFGNNPPKQAHHRGASVPVL
APNVVVNCPMSFVDWFNKDTPNPNELTGAILGGPDRTDNFNDKRSDSPMTEPVIYTNSLA
VGVLAKLAVHKF
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgggagttatgaacaccaataacgtttctacaactcccattcttcttcttgtttgttgc
cttgtttttcttcaatcaatagtatctcttcgtgtcgttaaagccgatttgaattacaaa
gatgctctcaccaaatcccttattttcctcgaagctcaacgctccggcaagctccctccc
aatcatcgcccagcttggagaggagactcagctctcgacgatggacaacttgccaacgtt
gacctagtgggaggatattacgacgcaggagacaatgtgaagtacggacttccgatggct
ttcaccattacaactctagcatggggagccttggcttacccggaagagattgaagccgcg
ggcgaaatggagaatgttaaagcggcactccaatggggaacagattatttcctcaaggct
gcttctcgtcgcaatcgtctctatgttcaggttggagatcctgtaaaggatcatgaatgt
tgggttagaccagaaaatatgaagactctaaggtctgtcttgcaaattgattcaaataca
cctggtacagaaattgcagctgaaacttcagctgccatggcttctgcttccatggtcttt
agaagctccaatcaaacatatgctcgtaggcttctcaacaaagccaaattgctttatcaa
ttggctaaaaaccacaaaggaacttacgatggagagtgccctttctattgctcttattct
ggtttcaatgatgagctgttgtgggctgccacctggctatacattgcaacaaagaggcca
gtttatttgaagtacattcaagaagagtccattagtgcaagtgtggctgaattcagctgg
gatctcaaatatgctggcgctcaaattcttctttccaagttttttttcgaaggagagaag
ggtttacaaatgtacaaaaatcaagcagatagttatatttgctctaatcttccagacagt
cctttccaccaaatctatgtatctccaggtggaatggttcacttgagagatggagccaac
acacaatatgttgctggaacagccttcttgtttagtgcttacagtgatctccttgcaact
tataagcaaactgctcaatgtgctgacaagagcttcgactcaacccaactcatgatgttc
gccaaaaaacagatggattacatattgggaaccaacccacaaggaagatcatacatggtt
gggttcggaaacaacccgccgaaacaagcccaccaccgtggagcgtcggtgccggttcta
gcgccaaacgtggtagtgaactgcccaatgagtttcgtggactggttcaacaaggacaca
cccaaccccaatgagctcaccggcgccattctcggcggccctgatcgaaccgacaacttc
aacgacaagcgttcggactcgcccatgaccgagccggtcatctacaccaactccctcgcc
gtcggagtcctcgcaaagctggccgtccacaaattttag

DBGET integrated database retrieval system