KEGG   Cucumis sativus (cucumber): 101204789Help
Entry
101204789         CDS       T02486                                 

Definition
endoglucanase 16-like
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101204789
Enzymes [BR:csv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     101204789
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 492 aa AA seqDB search
MGVMNTNNVSTTPILLLVCCLVFLQSIVSLRVVKADLNYKDALTKSLIFLEAQRSGKLPP
NHRPAWRGDSALDDGQLANVDLVGGYYDAGDNVKYGLPMAFTITTLAWGALAYPEEIEAA
GEMENVKAALQWGTDYFLKAASRRNRLYVQVGDPVKDHECWVRPENMKTLRSVLQIDSNT
PGTEIAAETSAAMASASMVFRSSNQTYARRLLNKAKLLYQLAKNHKGTYDGECPFYCSYS
GFNDELLWAATWLYIATKRPVYLKYIQEESISASVAEFSWDLKYAGAQILLSKFFFEGEK
GLQMYKNQADSYICSNLPDSPFHQIYVSPGGMVHLRDGANTQYVAGTAFLFSAYSDLLAT
YKQTAQCADKSFDSTQLMMFAKKQMDYILGTNPQGRSYMVGFGNNPPKQAHHRGASVPVL
APNVVVNCPMSFVDWFNKDTPNPNELTGAILGGPDRTDNFNDKRSDSPMTEPVIYTNSLA
VGVLAKLAVHKF
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgggagttatgaacaccaataacgtttctacaactcccattcttcttcttgtttgttgc
cttgtttttcttcaatcaatagtatctcttcgtgtcgttaaagccgatttgaattacaaa
gatgctctcaccaaatcccttattttcctcgaagctcaacgctccggcaagctccctccc
aatcatcgcccagcttggagaggagactcagctctcgacgatggacaacttgccaacgtt
gacctagtgggaggatattacgacgcaggagacaatgtgaagtacggacttccgatggct
ttcaccattacaactctagcatggggagccttggcttacccggaagagattgaagccgcg
ggcgaaatggagaatgttaaagcggcactccaatggggaacagattatttcctcaaggct
gcttctcgtcgcaatcgtctctatgttcaggttggagatcctgtaaaggatcatgaatgt
tgggttagaccagaaaatatgaagactctaaggtctgtcttgcaaattgattcaaataca
cctggtacagaaattgcagctgaaacttcagctgccatggcttctgcttccatggtcttt
agaagctccaatcaaacatatgctcgtaggcttctcaacaaagccaaattgctttatcaa
ttggctaaaaaccacaaaggaacttacgatggagagtgccctttctattgctcttattct
ggtttcaatgatgagctgttgtgggctgccacctggctatacattgcaacaaagaggcca
gtttatttgaagtacattcaagaagagtccattagtgcaagtgtggctgaattcagctgg
gatctcaaatatgctggcgctcaaattcttctttccaagttttttttcgaaggagagaag
ggtttacaaatgtacaaaaatcaagcagatagttatatttgctctaatcttccagacagt
cctttccaccaaatctatgtatctccaggtggaatggttcacttgagagatggagccaac
acacaatatgttgctggaacagccttcttgtttagtgcttacagtgatctccttgcaact
tataagcaaactgctcaatgtgctgacaagagcttcgactcaacccaactcatgatgttc
gccaaaaaacagatggattacatattgggaaccaacccacaaggaagatcatacatggtt
gggttcggaaacaacccgccgaaacaagcccaccaccgtggagcgtcggtgccggttcta
gcgccaaacgtggtagtgaactgcccaatgagtttcgtggactggttcaacaaggacaca
cccaaccccaatgagctcaccggcgccattctcggcggccctgatcgaaccgacaacttc
aacgacaagcgttcggactcgcccatgaccgagccggtcatctacaccaactccctcgcc
gtcggagtcctcgcaaagctggccgtccacaaattttag

  All links  
No link information was found.   
DBGET integrated database retrieval system