KEGG   Cucumis sativus (cucumber): 101204869Help
Entry
101204869         CDS       T02486                                 

Definition
palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic-like
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    101204869
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    101204869
Enzymes [BR:csv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     101204869
Lipid biosynthesis proteins [BR:csv01004]
 Desaturase
  First
   101204869
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 293 aa AA seqDB search
MDEVSKEKPKEMVMKSPPRLFRRKKWTKFDRNVAFYFLSLHLLCILAPFYFSWTCLLLAL
GLSYLTGMGISVSYHRNLAHRSFKLPKWLEYSLAYIATHAIQGDPIDWVSTHRCHHRFVD
SARDPHSPIFMFYMKHGYPDNVTDLEKQKFYRFIHKTYWLHPLALSLLLYAIGGLPFIIW
GMCVRFVYSLHVTSMVNSVCHIWGNQPWNTGDLSKNNWMVALLTFGEGWHNNHHAFEYSA
RHGHEWWQIDYGWYLIRFLQVIGLATNVKLPSEKQKLAALNKSKPIFLKLMID
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagtatccaaagaaaagccaaaggagatggtgatgaaatctcctccaaggctc
tttaggagaaaaaaatggacaaagtttgatagaaacgttgccttttactttctcagtttg
catctactttgtattttggcacccttctattttagttggacctgtttgttgctcgcctta
ggcttatcttatttaacaggtatgggaataagtgtctcgtatcatcgaaatcttgcacat
cgaagcttcaagcttccaaaatggcttgagtattctcttgcttatattgcaactcatgca
atccagggtgatccaattgattgggtgagtacacatagatgtcaccatcgattcgttgat
tcagcacgagatccacatagtcctatcttcatgttttacatgaaacatggatatccagac
aatgtgacagatttggagaaacaaaagttctataggtttatacataaaacatattggctt
catccacttgccctttcactcttgctctatgccattggaggactacctttcatcatttgg
ggaatgtgcgtgaggttcgtatacagcttgcatgtgacatctatggtcaattcagtatgt
catatatggggaaatcaaccatggaatactggtgatttatccaagaataattggatggta
gctttattaacctttggagaaggatggcacaataaccaccatgcttttgagtattcagcg
agacatggtcatgagtggtggcaaattgattatggttggtatcttattaggttccttcag
gtcattggattagcaaccaatgtgaaattaccttctgaaaagcaaaaattggctgcttta
aacaaatcaaaacccatctttcttaagcttatgattgattga

DBGET integrated database retrieval system