KEGG   Cucumis sativus (cucumber): 101205339Help
Entry
101205339         CDS       T02486                                 

Definition
pectinesterase PPME1-like
Organism
csv  Cucumis sativus (cucumber)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 364 aa AA seqDB search
MDALAITTLVTFLATFTAILAVPSPMVPVDKAQLEAWFSENVKPFADRNKAELDPAVVAA
EGNVTIVKVMGDGTGDFKTITEAIASVPVNNKNRVVIWIGEGVYKEKLTIEKNKPFITLC
GTPKNVPTLSFDGVASKYGTVYSATLIVEADYFVAANLIIENTSPRPNGRKEAQALAARF
RGTKSAFYNCKFFGFQDTLCDDDGLHLYKDCFIQGTVDFVFGKGTSLYLNTELNVVGEGQ
FAVITAHSREQEADASGYSFVHCSITGNGKDTYLGRAWMPRSRVIFAYTSMIDIIHPEGW
NDMKHAGFDKTVMFGEYKCSGPGAVSTGRVAYGKQLTEAEVKPYLSLEFVQSAKWLLPPP
NPQA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggatgcactcgccattacaacattggtaactttcctagcaacttttactgccatcttg
gccgtaccatcgccgatggtcccggtcgataaggcacaattagaagcgtggttttcagaa
aatgtgaagccgtttgccgatcgtaataaggcagagcttgatccagcggtggtggctgca
gaaggaaatgtgaccatagttaaggttatgggtgatggaacaggagatttcaagacaatc
actgaagctattgcgagcgtgccagtgaacaacaagaatcgtgtagtaatttggattgga
gaaggcgtttataaggagaagcttacaattgagaaaaataagccttttattactctttgt
ggcactcctaaaaacgtacctactttgtcttttgatggcgttgcttctaaatatggcacg
gtttatagcgctaccttgattgttgaggctgattatttcgttgcggctaatttgatcatt
gagaatacatcaccaaggccaaatggaagaaaagaagcacaagcattagcagcaagattt
aggggaactaaatccgcattttacaattgcaaattctttggatttcaagataccctttgt
gacgatgacggtttacatctctacaaagattgcttcattcaaggcactgttgatttcgtt
tttggaaaaggaacttccctttatttgaacaccgaattgaatgtggtgggagagggacaa
ttcgcagtgataacagctcattcaagagaacaagaagctgacgctagtggatattcgttt
gttcattgcagcattaccggaaacggtaaagacacatatttgggaagagcttggatgcca
agatctagagttatctttgcctacacttcaatgattgatatcattcatcccgaaggctgg
aacgacatgaagcatgccggtttcgacaagacggttatgtttggagaatacaagtgttcg
gggccaggagcggtgtcgaccggacgtgtagcctacgggaagcaactgactgaagcagaa
gtgaagccatatcttagtctcgaattcgtgcaaagtgcaaagtggttgcttcctcctccc
aatcctcaagcttag

DBGET integrated database retrieval system