KEGG   Cucumis sativus (cucumber): 101205575Help
Entry
101205575         CDS       T02486                                 

Definition
(RefSeq) putative pectinesterase 63
Organism
csv  Cucumis sativus (cucumber)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
6
AA seq 368 aa AA seqDB search
MKLRMDALAITTLVTFLATFTAILAVPSPMVPVDKAQLEAWFSENVKPFADRNKAELDPA
VVAAEGNVTIVKVMSDGTGDFKTVTEAIASVPVNNKNRVVIWIGEGVYKEKLTIEKNKPF
ITLCGTPKNVPTLTFDGVASKYGTVYSATLIVEADYFVAANLIIENTSPRPNGRKEAQAL
AARFRGTKSAFYNCKFLGFQDTLCDDDGLHLYKDCFIQGTVDFVFGKGTSLYLNTELNVV
GEGQFAVITAHSREQEADASGYSFVHCSITGNGKDTFLGRAWMPRSRVIFAYTSMIDIIH
PEGWNDMKHAGFDKTVMFGEYKCSGPGAVSTGRVAYGKQLTEAEVKPYLSLEFVQSAKWL
LPPPNPQA
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttcgcatggatgcactcgccattacaacattggtaactttcctagcaactttt
actgccatcttggccgtaccatcgccgatggtcccggtcgataaggcacaattagaagcg
tggttttcagaaaatgtgaagccgtttgccgaccgtaataaggctgagcttgatccagcg
gtggtggctgcagaaggaaacgtgaccatagttaaggtaatgagtgatggaacgggagat
ttcaagacagtcactgaagctattgcgagcgtgccagtgaacaacaagaatcgtgtagta
atttggattggagaaggcgtttataaggagaagcttaccattgagaaaaataagcctttt
attactctttgtggcactcctaaaaacgtacctactttgacatttgatggcgttgcatcc
aaatatggcacggtttatagcgctaccttgattgttgaggctgattatttcgttgcggct
aatttgatcattgagaatacatcaccaaggccaaacgggagaaaagaagcacaagcatta
gcagcaagatttaggggaactaaatccgcgttttacaattgcaaattccttggatttcaa
gataccctttgtgacgacgacggtttacatctctacaaagattgcttcattcaaggcact
gttgatttcgtttttggaaaaggaacttccctttatttgaacaccgaattgaatgtggtg
ggagagggacaattcgcagtgataacagctcattcaagagaacaagaagctgacgctagt
ggatattcgtttgttcattgcagcattaccggaaacggtaaagacacatttttgggaaga
gcttggatgccaagatctagagttatctttgcctacacttcaatgattgatatcattcat
cccgaaggctggaatgacatgaagcatgccggtttcgacaagacggttatgtttggagaa
tacaagtgttcggggccaggagcggtgtcgaccggacgtgtagcctacgggaagcaactg
actgaagcagaagtgaagccatatcttagtctcgaattcgtgcaaagtgcaaagtggttg
cttcctcctcccaatcctcaagcttag

DBGET integrated database retrieval system