KEGG   Cucumis sativus (cucumber): 101206719Help
Entry
101206719         CDS       T02486                                 

Definition
(RefSeq) endoglucanase 24-like
  KO
K01179  
endoglucanase [EC:3.2.1.4]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101206719
Enzymes [BR:csv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     101206719
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 496 aa AA seqDB search
MKNPIFSHRTILFLILSILFSLHSAFAAHDYADALSKCILFFEGQRSGFLPQDQRMTWRA
NSGLGDGWTYKTDLTGGYYDAGDNVKFGFPMAFTTTLLSWSVIEFGDFMPPAELRNSLVA
IRWATDYLLKTVSEPNRIFVQVGDPSADHSCWERPEDMDTTRTVYAVDAPGTASDVAGET
AAALAAASMAFRSSNPEYAETLLRNGIKAFELADTYRGAYSDNANIRDGVCPFYCDFDGY
QDELLWGAAWLRRASQNESYLNYIQDNGKTLGAEDSYNEFGWDNKHAGLNVLVSKEALEG
NIFTLQSYRASADNFMCTLIPESSSSHIQYTPGGLIYKPGGSNLQHATSITFLLLAYANY
LERTSSTVNCGNVVVGPATLRRQAKQQVDYILGENPKGISYMVGYGNYFPQRIHHRGSSL
PSVHDHPQPIACKEGSAYFNSADPNPNVLVGALVGGPGEDDVYEDDRADFRKSEPTTYIN
APFVGVLAYFAANPGG
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaccccattttctctcaccggaccattcttttcctcattctttcaattctcttc
tccctccactctgcatttgccgctcatgattacgccgacgccttgtctaaatgtatcttg
ttcttcgaaggccaacgatcgggcttcttgcctcaagatcaacgaatgacgtggcgtgcc
aactccggcctcggcgacggttggacttataaaacagacctcaccggcggctactacgac
gccggagacaatgttaagtttggttttccgatggctttcaccaccacgcttttgtcttgg
agtgtcattgagttcggcgacttcatgccgccggcggagttgaggaattcgttggttgcg
attcgttgggccacggattatctcctcaaaacggtgtcggagcctaatcggatttttgtt
caggtgggtgatccgagtgcggaccattcttgttgggagagacccgaggacatggacacg
accagaaccgtgtatgccgtggacgcaccagggactgcttcagatgtggcgggggagact
gcagcagcattagctgctgcgtcgatggcgttccggtcgtcgaacccagagtatgcagag
acgttgctacgaaatggaattaaggcattcgagttggctgatacctatagaggagcttat
agtgataatgctaatattagagacggtgtttgtcctttctactgcgattttgatggctat
caggatgagctactatggggagcagcttggctaagaagggcgagtcaaaatgagtcgtat
ttgaattatattcaagacaatggtaaaactcttggtgctgaagatagctacaatgagttt
ggatgggacaacaagcatgctggtcttaacgttctcgtctctaaggaagcacttgaagga
aacatattcacactccaatcatacagagcctcggcagataatttcatgtgcacattaatt
ccggagtcttcttcttcccacatccaatacactcccggcggcctcatctacaagcccggc
ggcagcaacctccaacacgccacctccataaccttcctcctcctcgcctacgctaactac
ctcgaacgcacttcctccaccgtcaactgcggcaacgtcgtcgtcggtcccgccaccctc
cgccgccaagccaaacaacaagtcgactacatcctcggcgaaaatcccaagggcatctcc
tacatggtcggctatggcaactacttccctcagcggatccaccaccgcggctcctccctt
ccttctgtacacgaccatccgcagccgatcgcttgtaaggaagggtcggcgtacttcaac
tcggcagatccgaaccctaatgtgttggttggagccttagttggtggtccgggggaagat
gatgtgtatgaggatgatcgggcggattttcggaaatcggagccgactacttatattaat
gcgccttttgttggagttttggcgtattttgctgcgaacccgggaggttga

DBGET integrated database retrieval system