KEGG   Cucumis sativus (cucumber): 101207254Help
Entry
101207254         CDS       T02486                                 

Definition
(RefSeq) alanine aminotransferase 2-like
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00220  Arginine biosynthesis
csv00250  Alanine, aspartate and glutamate metabolism
csv00710  Carbon fixation in photosynthetic organisms
csv01100  Metabolic pathways
csv01200  Carbon metabolism
csv01210  2-Oxocarboxylic acid metabolism
csv01230  Biosynthesis of amino acids
Module
csv_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101207254
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101207254
   00220 Arginine biosynthesis
    101207254
Enzymes [BR:csv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     101207254
Amino acid related enzymes [BR:csv01007]
 Aminotransferase (transaminase)
  Class I
   101207254
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 101207254
NCBI-ProteinID: XP_004144444
UniProt: A0A0A0LC12
Position
3
AA seq 535 aa AA seqDB search
MRKYAPVTASLITDLLRHRSRQSSRLLSSTHILDHPSSSSPSPSPSSSLMSSSSNHPLSI
ATINDKVLKCEYAVRGEIVTLAQKLQEELSVKPGSHPFDEILYCNIGNPQSLGQQPITFF
REVLALCDHPAILDKSETQGLFSTDAIARAWQILDQIPGRATGAYSHSQGIKGLRDTIAA
GIEARDGYPADPNDFFLTDGASPAVHMMMQLLIRSEGDGILCPIPQYPLYSASIALHGGT
LVPYYLDEATGWGLETSELKKQLEAAKSKGINVRALVVINPGNPTGQVLAEDNQRQIVEF
CKQEGLVLLADEVYQENIYAPDKKFHSFKKISRSMGYGNEDIALVSFQSVSKGYYGECGK
RGGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLVMNPPKVGDESFESYSAEKDGI
LSSLERRAKALEDALNSLEGVECNKAEGAMYLFPRIYLPAKAIKAAEAVNTSPDTFYCRR
LLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLTEFHKQFMEEFRD
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaatacgctcctgttaccgcttcactgatcactgatcttcttcgccaccgctcc
cgtcaatcctctcgccttttgtcctcaacccatattctcgatcacccctcttcttcttct
ccttctccttctccttcttcctcactcatgtcttcttcttccaatcacccgctttctatc
gccaccattaacgataaggtgcttaaatgtgagtatgctgtcagaggtgaaatcgtcact
ctcgcacagaaattacaagaagagttatcggtgaagcccggttcacatccttttgatgag
atactctactgcaacattggaaaccctcagtcccttggtcagcagccaataactttcttc
cgtgaggttcttgcattgtgcgatcatcctgctattttggacaaaagtgaaacacagggt
ttgttcagtactgatgccatcgcgagagcctggcaaattctagaccaaatacctggaaga
gcaactggtgcatatagtcacagccagggtatcaagggtttgcgtgatacaattgctgct
ggaattgaagctcgtgatggatatcctgccgatcccaatgattttttcctaacagatggt
gcaagcccagcagtccacatgatgatgcaattgcttataagatcagaaggggatggaatt
ctttgtccaattcctcagtaccctttgtactctgcttcaatagctctccatggtggcacc
ctggtcccatactatcttgatgaagccacagggtggggactggaaacttctgagcttaag
aagcaactggaggctgccaagtccaagggtataaatgttagggcactggtggtaataaat
cctgggaatcccacaggacaggttcttgctgaggataatcagcggcagattgtggaattc
tgcaaacaagagggacttgttcttcttgcggatgaggtatatcaggaaaacatttacgct
cccgataaaaagttccactcttttaagaagatttcccggtctatgggttatggcaatgag
gatatcgcattggtgtcgtttcagtcagtctctaaaggttactatggtgagtgtggaaag
agaggtggatacatggaggttactggtttcagtcctgagataagggaacaaatatataaa
gtggcatcagtgaatctgtgttctaacatttctggccagattctagccagccttgtaatg
aatcccccaaaggttggagatgaatcttttgaatcatatagtgcagagaaggatggaata
ctatcttcgctggaaagacgtgcaaaggcactggaagatgctctaaacagtctagaaggt
gtggagtgcaacaaagctgaaggggccatgtatctctttcctcgtatttacctgcccgcg
aaggcaatcaaagcagctgaagctgtcaatacatctcctgatactttctattgtcgtcgc
ctccttaatgctactggaattgttgttgtgccaggttctggttttggtcaggttccgggt
acatggcattttagatgcaccatactacctcaagaggacaagattccagccattgtttca
cgtttgacagagttccacaaacaattcatggaagaattccgcgattga

DBGET integrated database retrieval system