KEGG   Cucumis sativus (cucumber): 101207254Help
Entry
101207254         CDS       T02486                                 

Definition
(RefSeq) alanine aminotransferase 2-like
  KO
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101207254
   01210 2-Oxocarboxylic acid metabolism
    101207254
   01230 Biosynthesis of amino acids
    101207254
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101207254
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101207254
   00220 Arginine biosynthesis
    101207254
Enzymes [BR:csv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     101207254
Amino acid related enzymes [BR:csv01007]
 Aminotransferase (transaminase)
  Class I
   101207254
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 535 aa AA seqDB search
MRKYAPVTASLITDLLRHRSRQSSRLLSSTHILDHPSSSSPSPSPSSSLMSSSSNHPLSI
ATINDKVLKCEYAVRGEIVTLAQKLQEELSVKPGSHPFDEILYCNIGNPQSLGQQPITFF
REVLALCDHPAILDKSETQGLFSTDAIARAWQILDQIPGRATGAYSHSQGIKGLRDTIAA
GIEARDGYPADPNDFFLTDGASPAVHMMMQLLIRSEGDGILCPIPQYPLYSASIALHGGT
LVPYYLDEATGWGLETSELKKQLEAAKSKGINVRALVVINPGNPTGQVLAEDNQRQIVEF
CKQEGLVLLADEVYQENIYAPDKKFHSFKKISRSMGYGNEDIALVSFQSVSKGYYGECGK
RGGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLVMNPPKVGDESFESYSAEKDGI
LSSLERRAKALEDALNSLEGVECNKAEGAMYLFPRIYLPAKAIKAAEAVNTSPDTFYCRR
LLNATGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLTEFHKQFMEEFRD
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaatacgctcctgttaccgcttcactgatcactgatcttcttcgccaccgctcc
cgtcaatcctctcgccttttgtcctcaacccatattctcgatcacccctcttcttcttct
ccttctccttctccttcttcctcactcatgtcttcttcttccaatcacccgctttctatc
gccaccattaacgataaggtgcttaaatgtgagtatgctgtcagaggtgaaatcgtcact
ctcgcacagaaattacaagaagagttatcggtgaagcccggttcacatccttttgatgag
atactctactgcaacattggaaaccctcagtcccttggtcagcagccaataactttcttc
cgtgaggttcttgcattgtgcgatcatcctgctattttggacaaaagtgaaacacagggt
ttgttcagtactgatgccatcgcgagagcctggcaaattctagaccaaatacctggaaga
gcaactggtgcatatagtcacagccagggtatcaagggtttgcgtgatacaattgctgct
ggaattgaagctcgtgatggatatcctgccgatcccaatgattttttcctaacagatggt
gcaagcccagcagtccacatgatgatgcaattgcttataagatcagaaggggatggaatt
ctttgtccaattcctcagtaccctttgtactctgcttcaatagctctccatggtggcacc
ctggtcccatactatcttgatgaagccacagggtggggactggaaacttctgagcttaag
aagcaactggaggctgccaagtccaagggtataaatgttagggcactggtggtaataaat
cctgggaatcccacaggacaggttcttgctgaggataatcagcggcagattgtggaattc
tgcaaacaagagggacttgttcttcttgcggatgaggtatatcaggaaaacatttacgct
cccgataaaaagttccactcttttaagaagatttcccggtctatgggttatggcaatgag
gatatcgcattggtgtcgtttcagtcagtctctaaaggttactatggtgagtgtggaaag
agaggtggatacatggaggttactggtttcagtcctgagataagggaacaaatatataaa
gtggcatcagtgaatctgtgttctaacatttctggccagattctagccagccttgtaatg
aatcccccaaaggttggagatgaatcttttgaatcatatagtgcagagaaggatggaata
ctatcttcgctggaaagacgtgcaaaggcactggaagatgctctaaacagtctagaaggt
gtggagtgcaacaaagctgaaggggccatgtatctctttcctcgtatttacctgcccgcg
aaggcaatcaaagcagctgaagctgtcaatacatctcctgatactttctattgtcgtcgc
ctccttaatgctactggaattgttgttgtgccaggttctggttttggtcaggttccgggt
acatggcattttagatgcaccatactacctcaagaggacaagattccagccattgtttca
cgtttgacagagttccacaaacaattcatggaagaattccgcgattga

DBGET integrated database retrieval system