KEGG   Cucumis sativus (cucumber): 101207254Help
Entry
101207254         CDS       T02486                                 

Definition
alanine aminotransferase 2, mitochondrial-like
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Alanine, aspartate and glutamate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
C4-dicarboxylic acid cycle, NAD - malic enzyme type
Class
Metabolism; Overview; Carbon metabolism [PATH:csv01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:csv01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:csv01230]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:csv00710]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:csv00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 528 aa AA seqDB search
MRKYAPVTASLITDLLRHRSRQSSRLLSSTHILDHPSSSSPSPSSSSNHPLSIATINDKV
LKCEYAVRGEIVTLAQKLQEELSVKPGSHPFDEILYCNIGNPQSLGQQPITFFREVLALC
DHPAILDKSETQGLFSTDAIARAWQILDQIPGRATGAYSHSQGIKGLRDTIAAGIEARDG
YPADPNDFFLTDGASPAVHMMMQLLIRSEGDGILCPIPQYPLYSASIALHGGTLVPYYLD
EATGWGLETSELKKQLEAAKSKGINVRALVVINPGNPTGQVLAEDNQRQIVEFCKQEGLV
LLADEVYQENIYAPDKKFHSFKKISRSMGYGNEDIALVSFQSVSKGYYGECGKRGGYMEV
TGFSPEIREQIYKVASVNLCSNISGQILASLVMNPPKVGDESFESYSAEKDGILSSLERR
AKALEDALNSLEGVECNKAEGAMYLFPRIYLPAKAIKAAEAVNTSPDTFYCRRLLNATGI
VVVPGSGFGQVPGTWHFRCTILPQEDKIPAIVSRLTEFHKQFMEEFRD
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaatacgctcctgttaccgcttcactgatcactgatcttcttcgccaccgctcc
cgtcaatcctctcgccttttgtcctcaacccatattctcgatcacccctcttcttcttct
ccttctccttcttcttcttccaatcacccgctttctatcgccaccattaacgataaggtg
cttaaatgtgagtatgctgtcagaggtgaaatcgtcactctcgcacagaaattacaagaa
gagttatcggtgaagcccggttcacatccttttgatgagatactctactgcaacattgga
aaccctcagtcccttggtcagcagccaataactttcttccgtgaggttcttgcattgtgc
gatcatcctgctattttggacaaaagtgaaacacagggtttgttcagtactgatgccatc
gcgagagcctggcaaattctagaccaaatacctggaagagcaactggtgcatatagtcac
agccagggtatcaagggtttgcgtgatacaattgctgctggaattgaagctcgtgatgga
tatcctgccgatcccaatgattttttcctaacagatggtgcaagcccagcagtccacatg
atgatgcaattgcttataagatcagaaggggatggaattctttgtccaattcctcagtac
cctttgtactctgcttcaatagctctccatggtggcaccctggtcccatactatcttgat
gaagccacagggtggggactggaaacttctgagcttaagaagcaactggaggctgccaag
tccaagggtataaatgttagggcactggtggtaataaatcctgggaatcccacaggacag
gttcttgctgaggataatcagcggcagattgtggaattctgcaaacaagagggacttgtt
cttcttgcggatgaggtatatcaggaaaacatttacgctcccgataaaaagttccactct
tttaagaagatttcccggtctatgggttatggcaatgaggatatcgcattggtgtcgttt
cagtcagtctctaaaggttactatggtgagtgtggaaagagaggtggatacatggaggtt
actggtttcagtcctgagataagggaacaaatatataaagtggcatcagtgaatctgtgt
tctaacatttctggccagattctagccagccttgtaatgaatcccccaaaggttggagat
gaatcttttgaatcatatagtgcagagaaggatggaatactatcttcgctggaaagacgt
gcaaaggcactggaagatgctctaaacagtctagaaggtgtggagtgcaacaaagctgaa
ggggccatgtatctctttcctcgtatttacctgcccgcgaaggcaatcaaagcagctgaa
gctgtcaatacatctcctgatactttctattgtcgtcgcctccttaatgctactggaatt
gttgttgtgccaggttctggttttggtcaggttccgggtacatggcattttagatgcacc
atactacctcaagaggacaagattccagccattgtttcacgtttgacagagttccacaaa
caattcatggaagaattccgcgattga

DBGET integrated database retrieval system