KEGG   Cucumis sativus (cucumber): 101207674Help
Entry
101207674         CDS       T02486                                 

Definition
(RefSeq) arginase 1, mitochondrial
  KO
K01476  arginase [EC:3.5.3.1]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00220  Arginine biosynthesis
csv00330  Arginine and proline metabolism
csv01100  Metabolic pathways
csv01110  Biosynthesis of secondary metabolites
csv01230  Biosynthesis of amino acids
Module
csv_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    101207674
   00330 Arginine and proline metabolism
    101207674
Enzymes [BR:csv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     101207674
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 101207674
NCBI-ProteinID: XP_004145005
UniProt: A0A0A0KCX8
Position
6
AA seq 338 aa AA seqDB search
MSVLGRRGIHYFQKLNSANIPSALIEKGQNRVIEASLTLIRERAKLKGELVRALGGAVAS
ASLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNPTTEEGKELTDPRVLTDVGDVPVQE
IRDCGVDDERLMKVVSESVKLVMEEDPLRPLVLGGDHSISYPVVRAVSEKLGGQVDILHL
DAHPDNYDAYEGNYFSHASSFARIMEGGYARRLLQVGIRSISQEGRDQCKRFGVELYEMR
NFSRDREYLENLKLGEGVKGVYVSIDVDSLDPAFAPGVSHIEPGGLSFRDVMNIVQNLKG
DIVGADVVEFNPQRDTVDGMTAMVAAKLVRELTAKIAK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttttgggacggagaggcattcattactttcagaaactaaattctgcaaatatt
ccatccgcattgattgagaagggtcagaatcgtgttattgaagcatctctaacactcatt
cgtgagagagcgaagctcaagggtgagcttgtgcgtgctttaggaggtgctgtagcatca
gcttctcttcttggagttcctttgggacataactcatcatttcttcaaggtccagccttt
gcacctcctcggatcagggaggcaatctggtgcgggagcacaaatccaactacagaagaa
gggaaagaacttactgacccaagagtgctgactgatgttggcgatgtccctgtccaagag
atcagggactgtggcgtagatgatgaaagattgatgaaagttgtgagcgagtctgtaaag
ctggtgatggaagaggatccactacgcccattggttttaggaggcgaccactccatatct
taccctgttgtcagagcagtctctgagaagcttgggggtcaagttgatattcttcatcta
gatgcccatcctgataattatgatgcttatgaaggaaactatttttcacacgcttcttct
tttgcacgaattatggaaggtggttatgccaggcgacttttgcaagttggtataagatca
atatcacaagaaggacgagaccagtgcaaaagatttggagtggagctatatgaaatgcga
aacttttcaagagatcgtgaatatttggaaaatttgaaattgggagagggcgtaaaaggt
gtttatgtttcaatagatgttgactctttggatccagcatttgctccaggagtgtctcat
attgaaccaggaggtttgtctttccgtgatgttatgaacattgtccagaatctcaaaggg
gatattgtgggtgcagatgttgtcgagttcaaccctcagcgagacactgtcgatgggatg
acagccatggttgctgctaagttggtaagagaactcacagctaagatagcaaagtga

DBGET integrated database retrieval system