KEGG   Cucumis sativus (cucumber): 101207819Help
Entry
101207819         CDS       T02486                                 

Definition
histone deacetylase 5-like
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
csv  Cucumis sativus (cucumber)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 659 aa AA seqDB search
MDVDGSGTTKFNGINGDSRRLGVLYDDRMCKHHTPDGDYHPENPYRIRAIWNKLHSAGIL
QRCVVLKGKEAEDKHILAVHSKNHVKLIKEISSKEFDSRRDKIASKLNSIYFNEGSSEAS
YLAAGSVIDVAEKVAKGDLDSGIAIVRPPGHHAEHDEAMGFCLFNNIAVAASFILNERPD
LGIKKILIVDWDVHHGNATQKMFWEDPRVLFFSVHRHEYGSFYPATHDGFYTKVGEGPGA
GYNINVPWENGRCGDADYLAVWDHILLPVAEEYNPDMIMVSAGFDAAVGDPLGGCCVTPY
GYSIMLKKLMNLAQGKIVLALEGGYNLDSIASSMLACAELLLDGRTVNKPQETYPFESTW
QVIQAVRQELSPFWPILSDEIPDNLISKKVPLPEVLLSSSDSDDEASNGRLKSLEEVLQG
ITFSQLEVKEDSQGQAVNVTQPWRSELSKTDIWYAAFGSNLWCPRLLCYIRGGQVEGMKR
SCTGSMDTTPPKEIMWKSFPHRLFFGHEHTSTWGQGGVAFLNPESNSEEKSYLCLYRITL
EQFNDLLYQENNASSSLSDNPLLDIANLNKVTSSPSNSVEVPTGKGWYHNLVYLGKERDI
PILTMTCSHSDMEDFKDGKIPICSPAKEYVNTLVLGLAGGPLSKEEALEYIRNASTKPL
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggacgttgacggctccggaactacgaaattcaacggaatcaatggcgattcacggagg
ttaggagttttatacgacgataggatgtgtaaacatcacacacccgacggagactaccat
cctgagaatccttatcgaattagggccatttggaataagttacactccgctggcattctt
cagaggtgtgtggtcttgaaagggaaagaagcagaagataaacatattttggcagttcac
tccaaaaatcatgttaagttgattaaggaaataagctccaaagagtttgattcacgaaga
gataagattgcctcaaaacttaactccatatacttcaatgaagggtcatccgaagcttct
tatctggctgctggctctgtcatagatgttgctgaaaaagtagcaaaaggagacttagat
tctggcattgcgattgtgaggccgcccggtcatcatgctgaacatgatgaagctatgggg
ttttgtttgttcaacaatatagctgtggcagcaagctttattttgaatgaaagaccagat
ttgggtattaagaaaattttaattgtggattgggatgttcatcatggcaatgcaacacaa
aagatgttctgggaggatccccgtgttttgttcttctctgttcaccggcatgaatatgga
agtttctatccagccacacatgatggtttttataccaaggttggagaaggacctggagca
ggttataatataaatgtcccatgggagaatggacgatgtggggatgctgactacctagca
gtttgggaccatatcttgcttcctgttgctgaggaatacaaccctgatatgatcatggtc
tctgctggatttgatgcagctgttggggatcctctaggtggttgctgtgtcacaccatat
ggatactcgattatgttgaaaaagttgatgaatcttgcacaaggaaagattgtattggcc
ctggaaggaggatataatctcgactctatagcaagttcgatgcttgcctgtgcggaattg
ctgcttgatggaagaactgtgaataagcctcaagagacttatccatttgagtcaacatgg
caagtgatccaagcagttcgccaagaattgagtcctttttggccaattctttcagatgaa
ataccagacaatttgatcagtaaaaaggtgccactcccggaggtattgctttcaagctct
gattcagatgatgaagcttccaatggtagattaaaaagcctcgaggaagttcttcagggt
atcacattctcacaattggaagttaaggaagacagtcagggccaagcagttaatgttact
cagccttggagatcagagctatcaaaaactgatatctggtatgctgcatttggatcaaat
ttgtggtgcccaagattactttgttatatcagaggaggacaggttgagggtatgaagaga
tcatgtacaggttcaatggatactactccaccaaaggagattatgtggaaatcgtttcct
catcgtctatttttcggtcatgagcataccagtacatggggccaagggggagttgctttt
cttaatcccgaaagcaacagcgaggagaaatcttacttgtgcttgtatagaattacgctc
gagcaatttaacgaccttttgtatcaagaaaataatgctagtagttccctttctgataac
cctttattggatatagctaatttgaacaaagtcacaagcagcccttccaactctgttgag
gttccaactgggaaaggctggtaccacaacctcgtatatttggggaaagaacgcgatatt
ccaatactaactatgacatgttcacattcggatatggaagactttaaagatggaaaaatt
ccaatctgttcgccagcaaaagagtacgttaatacccttgttctaggccttgcaggaggg
ccactttcaaaggaggaagcactggaatatattcggaatgcttcaactaagccactgtaa

DBGET integrated database retrieval system