KEGG   Cucumis sativus (cucumber): 101207914Help
Entry
101207914         CDS       T02486                                 

Definition
glutamate--glyoxylate aminotransferase 2-like
Orthology
K14272  
glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44 2.6.1.-]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Alanine, aspartate and glutamate metabolism
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
C4-dicarboxylic acid cycle, NAD - malic enzyme type
Photorespiration
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101207914
   01210 2-Oxocarboxylic acid metabolism
    101207914
   01230 Biosynthesis of amino acids
    101207914
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    101207914
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101207914
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101207914
   00260 Glycine, serine and threonine metabolism
    101207914
Enzymes [BR:csv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     101207914
    2.6.1.4  glycine transaminase
     101207914
    2.6.1.44  alanine---glyoxylate transaminase
     101207914
    2.6.1.-  
     101207914
Amino acid related enzymes [BR:csv01007]
 Aminotransferase (transaminase)
  Class I
   101207914
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 473 aa AA seqDB search
MGLKALDYESINENMKKVEYAVRGELYLRASQLQKEGKKIIFTNVGNPHALGQMPLTFPR
QVIALCQAPFLLDDPNVGQLFPPDAIVRAKHYLSMIGGGLGAYSDSRGNPGVRKEVAEFI
ERRDGYPSDPELIYLTDGASKGVMQILNTIIRGEGDGILVPVPQYPLYSAAIALFGGSLV
PYYLDESSNWGLDLNDLRQSVARARSQGIMVKAMVIINPGNPTGQCLSEANLREILNFCF
QENLALLGDEVYQQNIYQDERPFISSKKVLMDMGPPISKELQLISFHTVSKGYWGECGQR
GGYFEMTNIPPQTVDEIYKIASISLSPNVPAQVFMGLMVNPLKPGDVSYEQYHRESKGIL
DSLRRRARIMTDGFNSCKNVVCNFTEGAMYSFPQIQLPPKAIETAKRAGKEADVFYCLKL
LEATGISTVPGSGFGQKEGVFHLRTTILPPEEEMPAIMASFKKFNDEFMEQYA
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgggtctgaaagcattagattatgagtctataaatgagaacatgaagaaggtagagtat
gcagttagaggagaattatatcttcgagcatcccagcttcagaaagaaggaaaaaagatt
atctttacaaatgttgggaatcctcacgctcttggccaaatgcctttgacctttcctcgt
caggtaattgctctttgccaagccccatttcttctagatgatcctaatgtaggacaatta
ttccctcctgatgcaattgtcagggccaaacattatctttcaatgattgggggtggttta
ggtgcttacagtgattcccgaggaaatccaggagtaagaaaggaggtggcagagttcata
gaaaggcgtgatggctatccgagtgatccagaactgatatatctcacggatggggccagc
aaaggtgtgatgcaaatactgaatactataatccgtggtgaaggtgatgggattcttgtt
ccggtccctcagtatccactttactctgcagcaattgctctgtttggtggttccttggtt
ccatattatttagatgagagctccaactggggtcttgatctcaatgatcttcgtcagtca
gttgcacgagctcgctctcagggaatcatggtaaaagcaatggtaatcataaaccccggt
aacccaactggtcaatgccttagtgaagcaaatttaagagaaatattgaacttctgtttt
caagaaaatctagcactacttggtgatgaagtttatcagcaaaacatctatcaggatgaa
agacctttcattagttctaaaaaggtattaatggatatggggcctcccatcagcaaggaa
cttcagctcatatcattccacactgtgtcaaagggatattggggagagtgtggacaacgt
ggtggatactttgagatgacaaacattcctcctcagacagtggatgagatatacaaaatt
gcatcaatatctctcagtccaaatgttcctgcacaagtgtttatgggactcatggtcaat
cccctcaaacctggtgatgtttcctatgagcaatatcatcgtgaaagcaaagggatcctt
gactcactgagaagaagggcaaggattatgacagatggttttaacagctgcaaaaatgta
gtctgcaacttcactgaaggtgccatgtattcattccctcaaatccagttgcctcctaaa
gcaatagagacagcaaaaagagcaggaaaagaagctgacgtcttctactgtcttaagctt
ttggaagccactggaatctccaccgtcccaggctcaggatttggacagaaagaaggggtc
ttccatttgcgaacaaccatattaccgccagaggaggagatgccagcgatcatggcaagt
tttaaaaagttcaatgatgagttcatggaacaatatgcatag

DBGET integrated database retrieval system