KEGG   Cucumis sativus (cucumber): 101208515Help
Entry
101208515         CDS       T02486                                 

Definition
(RefSeq) palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic-like
  KO
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    101208515
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    101208515
Enzymes [BR:csv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     101208515
Lipid biosynthesis proteins [BR:csv01004]
 Desaturase
  First
   101208515
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 349 aa AA seqDB search
MSLSPQMEATRKELEDKNNDHKAMTVEGKARVRPRRRRPLFRRKWTLLDRRSFGGVMAMH
LLSLLAPFYFTWPAFWLAVVLYILTGLFGVTLSYHRQLSHKSFKLPKWLEYTFAYMGVHA
LQGDPIDWASTHRIHHQFVDTERDPHSPSVEGFFFGHIAWIFDSYGLTEKVNPKYVESFK
ERDEKRKTFSNIFVGYLKYGRPKNVEDLQKQAFYRFIRSTYILHHFGLAIILYVVGGLPF
LVWGMGVRIVCFQHVTFFLNSAGHLWGSQQWNTGDQSRNNWMVALFMFGEGWHNNHHAFE
YSARHGLEWWQFDVTWWIILFLEAIGLATDVKLPSRNHMQKLAIQPKIE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtcccttagtcctcaaatggaggccacaagaaaagagctggaagataaaaataatgat
cacaaggctatgacggtagaaggcaaagctcgagttaggcctcgaagaagaaggccgctt
tttcgaagaaaatggacacttttagacagacgctcttttggtggtgttatggctatgcat
ttgcttagtctcttggcaccattttatttcacatggccagccttctggcttgctgttgta
ctctacattctcacaggcttgttcggcgtgacgctctcataccacagacaactctcgcac
aaaagtttcaaacttcccaaatggctcgaatacacatttgcatatatgggagttcatgct
cttcaaggcgatccaatcgattgggcgagcacacatagaattcatcatcagtttgttgat
acggaaagagatccacatagcccatcagtagaagggtttttctttggacatattgcttgg
atatttgattcatatggtttgacagaaaaagttaatccaaaatatgttgaaagttttaag
gaaagagatgaaaaaagaaagacatttagcaatatttttgtgggatatttgaagtatgga
agacctaaaaatgttgaggatttacaaaagcaagccttttataggtttattcgaagcaca
tacattcttcatcattttggccttgcaattattctctatgttgttggaggccttcccttt
ctcgtttggggaatgggtgtaagaattgtatgctttcaacatgtcactttcttcctaaac
tctgcaggccacttgtggggaagccaacagtggaacactggggatcagtccagaaataat
tggatggtggcattgtttatgtttggagaaggatggcacaataaccatcatgcatttgag
tattcagctcgacatggcctagaatggtggcagttcgacgtaacttggtggatcattttg
tttcttgaagcaatagggttagccactgatgtgaagttgccctctcgaaatcacatgcaa
aagttggccattcaacctaagatcgagtaa

DBGET integrated database retrieval system