KEGG   Cucumis sativus (cucumber): 101209316Help
Entry
101209316         CDS       T02486                                 

Definition
(RefSeq) pectinesterase QRT1
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00040  Pentose and glucuronate interconversions
csv01100  Metabolic pathways
Module
csv_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101209316
Enzymes [BR:csv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     101209316
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pectinesterase
Motif
Other DBs
NCBI-GeneID: 101209316
NCBI-ProteinID: XP_004150299
Position
7
AA seq 359 aa AA seqDB search
MNNGGFFPCIIVLGFLLLCVAGGSSGRGRGGVISWDDLRVDVWRRQRMSSSEGLGNGTRI
IVVDKNCSGDSTTVQGAVDMVPHNNKQRVKIYILPGIYREKVYIPITKPYISLIGNKNRV
TDTVITWNDKASDKSIDGVELGTYRTATVAIDSDYFCATGITFENTVVAKPGDKGRQGVA
LRITGDKAMFYRVKFLGGQDTLLDDLGTHYYYQCHIQGSVDFIFGTARSLYEQCVITSTA
ESYGAIAAHHRASPDDDTGFSFVRCVINGSGKVYLGRAWGNYSRTIYSNCYIEDVINPLG
WSDWNDPSRQRTVAFGQYNCRGSGASTKDWVKWAKTFNYEEVRPFVDRKYIKGEQWLNL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaataatggagggtttttcccttgcatcatcgttcttggttttcttctgctgtgtgtc
gctggagggagcagcggtaggggtcgtggtggtgtgatcagttgggatgatctgcgtgtg
gatgtttggcggcggcagaggatgagctccagcgaggggttggggaatgggaccagaatc
attgtggtcgataaaaattgctccggcgactccaccacggtgcaaggggcggtggatatg
gttcctcataataacaaacagagagttaagatttatattcttcctggcatttacagagag
aaggtatacatacccatcaccaagccatatatttccttgattggaaacaagaatagagtt
acagatactgttattacatggaatgacaaagcatcagacaaaagtatcgacggagtcgag
ctcgggacgtatagaacagcaacagttgcaatagactcagactacttttgtgccacagga
atcacatttgagaatacagttgtggcaaagccaggagataagggaagacaaggcgtagca
ttaagaataacaggagataaagcaatgttctatagagtgaaattcttgggaggacaagat
acacttctagatgatttgggcacacattattactatcaatgtcacattcaaggaagtgtt
gatttcatttttggtactgctagatcactctatgagcaatgtgtgataacttctacagca
gagagctatggagcaatagcagcacatcatcgagcctcaccagacgatgacaccggtttc
tccttcgtacgctgtgtgattaatggaagtgggaaagtatacctgggaagagcgtggggg
aactactcaagaacaatatattctaactgttacattgaagatgtaatcaatccattagga
tggagtgactggaatgacccatcaagacaaaggacagtagcttttgggcaatataattgc
aggggcagtggagctagcactaaagattgggtgaaatgggcaaagaccttcaactacgag
gaagtgagaccttttgtagataggaaatacatcaaaggagaacagtggcttaacttatga

DBGET integrated database retrieval system