KEGG   Cucumis sativus (cucumber): 101209367Help
Entry
101209367         CDS       T02486                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV1-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    101209367
   00500 Starch and sucrose metabolism
    101209367
Enzymes [BR:csv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     101209367
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
7
AA seq 585 aa AA seqDB search
MASYSSSLCFLNNIFLLIFLLFGHEFLQLQALHHVYRASHRTSHFVLHQHQQQPYRTSYH
FQPPKNWINDPNGPMIYKGIYHFFYQYNPKGAVWGNIVWAHSTSTDLINWEPHDHAIFPS
QPSDINGCWSGSATILPGEKPAILYTGINPKNQQVQNLAVPKNLSDPYLREWVKSPKNPL
MAPTPQNHINVSSFRDPTTAWLGRDGEWRVIIGSKIDARGLAIMYRSKDFVRWNQVDHPL
RYKDDMGMWECPDFFPVAKTGRTGVEMKVSGSHVKHILKVSLDDTKHDVYTVGTYNWKKD
IYIPNKGSIEGYNGLRYDYGKYYASKTFFDSQKKRRVLWGWVNESSSVDDDIKKGWSGVQ
AIPRAIWLDASGKQLIQWPIVEIQKLRNNKVKLTNEVLKKGSTIEVKGVTAAQADVEISF
KVENLKKAEILKPEWKDPQLLCSQKGTSSTTEGGSVGPFGLLVLASNDLKEYTSVFFTVF
KKPHKYVVLMCSDQSRSSLHSNNDKTTYGAFLDVDPTRENISLRSLIDHSIVESFGIKGK
GCITARVYPTLAIGDNVSLYAFNNGTDSVTITKLTAWSMKKAHIN
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttattcatcctctctttgcttcttgaataatatctttctcttgatctttctc
ttatttggccatgaatttttgcaactccaagctcttcaccatgtttatagagcttctcat
agaacatctcactttgttcttcatcagcaccaacaacaaccttacagaacttcctatcat
tttcaacctcccaagaattggattaatgatccaaatggtccaatgatatacaaaggaatt
tatcatttcttttaccaatacaatccaaaaggagcagtgtgggggaacattgtgtgggct
cactccacatcaacggacctgatcaattgggaaccccatgatcacgccatcttcccatct
cagccgtctgatatcaacggctgctggtcaggatccgccaccatcctccccggggagaaa
ccggcgattttgtacacaggaattaaccctaaaaaccaacaagttcaaaacttggctgtc
cccaagaacctctctgacccatatctaagagaatgggtcaaatccccaaaaaaccctctc
atggcccccaccccacaaaaccacatcaatgtcagctccttccgggaccccaccaccgcc
tggctgggtcgcgacggggagtggcgagtcatcattgggagcaaaattgatgcccgtgga
ctcgctatcatgtaccgaagtaaagatttcgtcaggtggaatcaggttgaccaccctcta
cgttacaaggatgacatgggaatgtgggagtgtccagatttcttccctgtggcaaaaacc
ggtcgaactggtgtggagatgaaagtgtctggatcgcacgtgaagcacatactgaaggtg
agcttggatgataccaagcacgacgtttatacggttggaacatataattggaaaaaagac
atttacattccaaataaaggatcaatagaaggttacaatgggttaagatatgattatggg
aagtattatgcttcaaaaacattctttgacagccagaagaagagaagggttttgtggggt
tgggtcaatgaatcttcaagtgtcgatgatgatatcaagaagggttggtccggtgtccag
gcaattccaagggctatttggctagatgcatctggaaaacaactcattcaatggccaatt
gtagaaattcaaaagcttcgaaacaacaaagttaaattgacaaatgaagttttgaagaaa
ggatcaaccattgaagtgaaaggtgtaacagcggcacaggcagatgtggagatttcattc
aaagtggaaaatttgaagaaagctgaaatattgaaacctgaatggaaagacccacagttg
ctttgtagccaaaagggaacatcgtcaactacagaaggtggatcagttggtccatttggg
cttttagttttggcttcaaatgacctcaaagagtacacttctgtcttctttacagtattc
aaaaaaccacacaaatatgttgttctcatgtgtagtgaccaaagcaggtcttctcttcac
tcgaataatgacaagacgacatatggagcattcttagacgtggatccaactcgtgaaaat
atttcactaagaagcttgatcgatcactcaatagtagaaagctttggaattaaaggaaag
ggttgcataacagcaagagtttatcccacattagccattggagacaatgttagtctctat
gctttcaacaatggaacagacagtgtcaccattacaaaactcactgcttggagcatgaag
aaagctcatatcaattga

DBGET integrated database retrieval system