KEGG   Cucumis sativus (cucumber): 101209591Help
Entry
101209591         CDS       T02486                                 

Definition
histidinol dehydrogenase, chloroplastic-like
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:csv01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:csv00340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 490 aa AA seqDB search
MDSQIIRLNWRCNFLGQQRRVQNFRTLCVPKSASFQSPYFPGGILGKGIKCSMKSYKLSE
LNQDAVTGLKARPRIDFSSIFGVVQPIADDVRKRGDAAVRDYTAKFDKVELNEIVVSVSD
LPEPELDSAVKEAFDVAYDNIYAFHAAQISVEKNVENMPGVKCKRVARSISSVGLYVPGG
TAVLPSTALMLSIPAQIAGCGTVVLATPPSQDGSICKEVLYCAKKAGVTHILKAGGAQAI
SAMAWGTESCPKVEKIFGPGNQYVTAAKMILQNSEAMISIDMPAGPSEVLVIADKYASPV
HIAADLLSQAEHGPDSQVVLVIAGDGVDVKAIEEELSKQCKSLPRGEFASKALSHSFTVF
ARDMVEAVSFSNLYAPEHLIINVKDAEKWESFIQNAGSVFLGPWTPESVGDYASGTNHVL
PTYGYARMYGGVSLDSFLKYMTIQSLTEEGLRKLGPYVEKMAEVEGLDAHKRAVSLRLKD
IEARKISSSR
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggacagccagattatacgcttgaattggaggtgtaatttcttgggtcaacaacgtagg
gtgcagaattttcgaactttgtgtgttccgaagtctgcttcttttcaaagtccttatttt
cccggaggaattttgggtaaaggcataaagtgttcaatgaagtcctataagttatctgaa
cttaatcaggatgctgtcactggtctaaaggcccgtcctcgtattgatttttcttcaata
tttggtgtggtccagcccattgctgatgatgttcgaaaaagaggtgatgctgcagttaga
gactatactgcaaagtttgacaaagttgaactgaacgagattgttgttagtgtctctgac
ctgccagagccagagcttgattcagctgtcaaagaagcctttgatgtagcttatgacaat
atatatgcatttcatgctgcccagatatcagtggaaaaaaatgttgaaaatatgcctgga
gtaaaatgcaaacgggtggcaagaagcatttcttctgttggtctctacgttcctggggga
actgctgttttaccctcaacggctttgatgctctctattcctgctcagattgctggttgc
ggtactgttgttcttgcaacacctcccagtcaggatggcagcatatgcaaggaggtgctc
tattgtgcgaagaaggcgggtgtgactcacattcttaaggcaggaggagctcaggctatc
tctgctatggcttggggaacagaatcttgccctaaggttgagaaaatttttggccctggt
aatcaatatgtaacagctgccaaaatgattcttcaaaatagtgaagcgatgatttcaatt
gacatgcctgcgggcccatctgaagttctggttattgctgataaatatgccagccccgtt
catatagcagcagatttgctttctcaggctgagcatggccctgacagtcaggttgttctt
gtaattgccggtgatggtgtggatgttaaagctattgaagaagaactcagcaaacaatgt
aaaagtcttccaaggggagagttcgcttcaaaagccctgagccatagttttactgtgttt
gctcgcgatatggttgaggcagtctccttttcaaacttatatgcacctgagcatttaata
attaatgtcaaggatgcagaaaaatgggagagtttcattcagaatgcaggttctgtcttc
ttggggccatggaccccagaaagcgtgggagattatgcaagtgggacgaatcatgttctt
ccaacctatggttatgcacggatgtatggtggagtttcgcttgactcatttttaaaatac
atgacgatacagtctttaacagaggagggtttaagaaaacttggtccctatgttgaaaaa
atggctgaagttgagggactggatgcccataaaagagctgtaagtcttagattgaaggat
attgaagccaggaaaatctcaagttcaaggtga

DBGET integrated database retrieval system