KEGG   Cucumis sativus (cucumber): 101209591Help
Entry
101209591         CDS       T02486                                 

Definition
histidinol dehydrogenase, chloroplastic-like
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    101209591
  Amino acid metabolism
   00340 Histidine metabolism
    101209591
Enzymes [BR:csv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     101209591
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 490 aa AA seqDB search
MDSQIIRLNWRCNFLGQQRRVQNFRTLCVPKSASFQSPYFPGGILGKGIKCSMKSYKLSE
LNQDAVTGLKARPRIDFSSIFGVVQPIADDVRKRGDAAVRDYTAKFDKVELNEIVVSVSD
LPEPELDSAVKEAFDVAYDNIYAFHAAQISVEKNVENMPGVKCKRVARSISSVGLYVPGG
TAVLPSTALMLSIPAQIAGCGTVVLATPPSQDGSICKEVLYCAKKAGVTHILKAGGAQAI
SAMAWGTESCPKVEKIFGPGNQYVTAAKMILQNSEAMISIDMPAGPSEVLVIADKYASPV
HIAADLLSQAEHGPDSQVVLVIAGDGVDVKAIEEELSKQCKSLPRGEFASKALSHSFTVF
ARDMVEAVSFSNLYAPEHLIINVKDAEKWESFIQNAGSVFLGPWTPESVGDYASGTNHVL
PTYGYARMYGGVSLDSFLKYMTIQSLTEEGLRKLGPYVEKMAEVEGLDAHKRAVSLRLKD
IEARKISSSR
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggacagccagattatacgcttgaattggaggtgtaatttcttgggtcaacaacgtagg
gtgcagaattttcgaactttgtgtgttccgaagtctgcttcttttcaaagtccttatttt
cccggaggaattttgggtaaaggcataaagtgttcaatgaagtcctataagttatctgaa
cttaatcaggatgctgtcactggtctaaaggcccgtcctcgtattgatttttcttcaata
tttggtgtggtccagcccattgctgatgatgttcgaaaaagaggtgatgctgcagttaga
gactatactgcaaagtttgacaaagttgaactgaacgagattgttgttagtgtctctgac
ctgccagagccagagcttgattcagctgtcaaagaagcctttgatgtagcttatgacaat
atatatgcatttcatgctgcccagatatcagtggaaaaaaatgttgaaaatatgcctgga
gtaaaatgcaaacgggtggcaagaagcatttcttctgttggtctctacgttcctggggga
actgctgttttaccctcaacggctttgatgctctctattcctgctcagattgctggttgc
ggtactgttgttcttgcaacacctcccagtcaggatggcagcatatgcaaggaggtgctc
tattgtgcgaagaaggcgggtgtgactcacattcttaaggcaggaggagctcaggctatc
tctgctatggcttggggaacagaatcttgccctaaggttgagaaaatttttggccctggt
aatcaatatgtaacagctgccaaaatgattcttcaaaatagtgaagcgatgatttcaatt
gacatgcctgcgggcccatctgaagttctggttattgctgataaatatgccagccccgtt
catatagcagcagatttgctttctcaggctgagcatggccctgacagtcaggttgttctt
gtaattgccggtgatggtgtggatgttaaagctattgaagaagaactcagcaaacaatgt
aaaagtcttccaaggggagagttcgcttcaaaagccctgagccatagttttactgtgttt
gctcgcgatatggttgaggcagtctccttttcaaacttatatgcacctgagcatttaata
attaatgtcaaggatgcagaaaaatgggagagtttcattcagaatgcaggttctgtcttc
ttggggccatggaccccagaaagcgtgggagattatgcaagtgggacgaatcatgttctt
ccaacctatggttatgcacggatgtatggtggagtttcgcttgactcatttttaaaatac
atgacgatacagtctttaacagaggagggtttaagaaaacttggtccctatgttgaaaaa
atggctgaagttgagggactggatgcccataaaagagctgtaagtcttagattgaaggat
attgaagccaggaaaatctcaagttcaaggtga

DBGET integrated database retrieval system