KEGG   Cucumis sativus (cucumber): 101209640Help
Entry
101209640         CDS       T02486                                 

Definition
xylose isomerase-like
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:csv00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:csv00051]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 476 aa AA seqDB search
MKSREISVLLLCLLALGFLQIANSHTCPADLSSECSHSGDWEGEFFPGIPKIKYEGPTSK
NPLAYKWYNADEEILGKKMKDWMRFSVAYWHTFRGTGADPFGAATKHWPWEDGTNSVAMA
KRRMRANFEFINKLGVEWWCFHDRDIAPDAPTLEETNANFDEVVAVAKELQGTKIKPLWV
TAQLFMHPRYMHGGATSSEVGVYAYAAAQVKKAMEVAHYLGAENYVFWGGREGYQTLLNT
DMGRELDHMARFFQAAVAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATSANFLRKYGLI
DEFQLNIECNHVTLSGHSCHHDLETARLNGILGSIDANTGDPQVGWDTDQFMTDIAEATM
VMLSVVRNGGLAPGGFNFDAKLRRESTDVEDLFIAHIGGMDTLARGLRNVAKLLEDGSLT
ELVRKRYESFDTEIGAQIEAGKADFEFLEKKALEWGEPKVPSAKQELAEMIFQSAL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctcgggaaatatcggttctgcttctgtgtttgcttgctttgggattcttgcag
attgctaattctcacacatgtcctgctgatctaagtagtgaatgcagtcattctggggat
tgggaaggggaatttttccctggtattcccaagattaagtatgagggtcccactagcaaa
aatccactggcatataaatggtataatgctgatgaggagattcttgggaagaaaatgaag
gactggatgagattcagtgttgcatattggcatacattccgtgggactggagcagaccca
tttggtgctgccaccaagcattggccatgggaagatggtaccaattcagtggctatggca
aagaggaggatgagagctaacttcgagttcataaacaaacttggggttgagtggtggtgc
ttccatgacagagatatagccccagatgcgcctactttggaggaaactaatgcaaacttt
gatgaagtggtggctgttgctaaagagcttcagggaaccaaaattaaacctctgtgggtt
acggcacaactcttcatgcaccctcgatacatgcacggtggtgctactagctctgaagtt
ggtgtttatgcttatgctgctgctcaagtcaagaaagcaatggaggtcgctcattatttg
ggggcagaaaactatgtattctggggtggccgtgagggttatcagactctactgaacact
gacatggggagagagcttgatcatatggctaggttttttcaagctgccgttgcctacaag
aagaagattggattcaatggaacattgttaattgaacccaagccccaagagcctacaaaa
caccaatatgattgggatgctgcaacatctgctaatttcctgcggaagtatggtcttatt
gatgaatttcagctcaacattgaatgcaatcatgtcaccctatcgggtcacagttgccac
catgatcttgaaactgcgaggctcaatgggattcttggaagcatcgatgcaaacactggc
gatcctcaagttggttgggatactgatcaatttatgaccgacatcgcagaggcgactatg
gttatgctaagtgttgtgagaaatggcggattggcacctggtggattcaactttgatgcg
aaattgcgaagagagagcacagatgttgaagatttgtttattgctcacattggtggaatg
gacacccttgcccgtggtcttcgaaatgttgctaagctacttgaggatggttctctaact
gagcttgttcgcaagagatacgagagttttgacactgagattggtgcacaaatagaggct
ggtaaggctgattttgagtttcttgagaagaaggccttggaatggggagagccaaaggtt
ccttctgccaagcaggaacttgctgagatgattttccagtcagcactgtga

DBGET integrated database retrieval system