KEGG   Cucumis sativus (cucumber): 101209640Help
Entry
101209640         CDS       T02486                                 

Definition
xylose isomerase-like
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101209640
   00051 Fructose and mannose metabolism
    101209640
Enzymes [BR:csv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     101209640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 476 aa AA seqDB search
MKSREISVLLLCLLALGFLQIANSHTCPADLSSECSHSGDWEGEFFPGIPKIKYEGPTSK
NPLAYKWYNADEEILGKKMKDWMRFSVAYWHTFRGTGADPFGAATKHWPWEDGTNSVAMA
KRRMRANFEFINKLGVEWWCFHDRDIAPDAPTLEETNANFDEVVAVAKELQGTKIKPLWV
TAQLFMHPRYMHGGATSSEVGVYAYAAAQVKKAMEVAHYLGAENYVFWGGREGYQTLLNT
DMGRELDHMARFFQAAVAYKKKIGFNGTLLIEPKPQEPTKHQYDWDAATSANFLRKYGLI
DEFQLNIECNHVTLSGHSCHHDLETARLNGILGSIDANTGDPQVGWDTDQFMTDIAEATM
VMLSVVRNGGLAPGGFNFDAKLRRESTDVEDLFIAHIGGMDTLARGLRNVAKLLEDGSLT
ELVRKRYESFDTEIGAQIEAGKADFEFLEKKALEWGEPKVPSAKQELAEMIFQSAL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctcgggaaatatcggttctgcttctgtgtttgcttgctttgggattcttgcag
attgctaattctcacacatgtcctgctgatctaagtagtgaatgcagtcattctggggat
tgggaaggggaatttttccctggtattcccaagattaagtatgagggtcccactagcaaa
aatccactggcatataaatggtataatgctgatgaggagattcttgggaagaaaatgaag
gactggatgagattcagtgttgcatattggcatacattccgtgggactggagcagaccca
tttggtgctgccaccaagcattggccatgggaagatggtaccaattcagtggctatggca
aagaggaggatgagagctaacttcgagttcataaacaaacttggggttgagtggtggtgc
ttccatgacagagatatagccccagatgcgcctactttggaggaaactaatgcaaacttt
gatgaagtggtggctgttgctaaagagcttcagggaaccaaaattaaacctctgtgggtt
acggcacaactcttcatgcaccctcgatacatgcacggtggtgctactagctctgaagtt
ggtgtttatgcttatgctgctgctcaagtcaagaaagcaatggaggtcgctcattatttg
ggggcagaaaactatgtattctggggtggccgtgagggttatcagactctactgaacact
gacatggggagagagcttgatcatatggctaggttttttcaagctgccgttgcctacaag
aagaagattggattcaatggaacattgttaattgaacccaagccccaagagcctacaaaa
caccaatatgattgggatgctgcaacatctgctaatttcctgcggaagtatggtcttatt
gatgaatttcagctcaacattgaatgcaatcatgtcaccctatcgggtcacagttgccac
catgatcttgaaactgcgaggctcaatgggattcttggaagcatcgatgcaaacactggc
gatcctcaagttggttgggatactgatcaatttatgaccgacatcgcagaggcgactatg
gttatgctaagtgttgtgagaaatggcggattggcacctggtggattcaactttgatgcg
aaattgcgaagagagagcacagatgttgaagatttgtttattgctcacattggtggaatg
gacacccttgcccgtggtcttcgaaatgttgctaagctacttgaggatggttctctaact
gagcttgttcgcaagagatacgagagttttgacactgagattggtgcacaaatagaggct
ggtaaggctgattttgagtttcttgagaagaaggccttggaatggggagagccaaaggtt
ccttctgccaagcaggaacttgctgagatgattttccagtcagcactgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system