KEGG   Cucumis sativus (cucumber): 101210229Help
Entry
101210229         CDS       T02486                                 

Definition
(RefSeq) palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic-like
  KO
K20416  
palmitoyl-[glycerolipid] 7-desaturase [EC:1.14.19.42]
Organism
csv  Cucumis sativus (cucumber)
Brite
Enzymes [BR:csv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.42  palmitoyl-[glycerolipid] 7-desaturase
     101210229
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
4
AA seq 302 aa AA seqDB search
MAKQNLKMILLSEKGMKRRREVFWGRKWNSLDIGTAGVVVATHLLTLFAPFQFNWAAFWV
AISLYIITGLFGITLSFHRNLSHRSFKLPKWLEYLFAYCGVQALQGNPIDWVSTHRYHHQ
FCDSERDPHSPIEGFWFSHMSWLFDTNSVVERCGEPNNVGDLEKQPFYKFIQTTYLLHPI
ALGALLYSMGGFPFIVWGMGVRIVWVYHITWLVNSACHVWGSQAWKTGDLSRNNWWVALL
AFGEGWHNNHHAFEFSARHGLEWWQLDMTWYVVRLLQAIGLATDVKIPTQLQKEKLAIIN
TT
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacaaaaccttaaaatgattttgttgtcggaaaaaggaatgaagcggcggagg
gaagtgttttggggaaggaaatggaattcgttagatatcggaacggctggagtggtggtg
gcgacgcatttacttacactttttgctccttttcaattcaattgggctgcattttgggtg
gcgatttctttatatataatcactggtctattcggtattaccctatcatttcatcggaat
ctctctcatcggagctttaaacttcctaaatggctcgaatatctcttcgcatattgtgga
gttcaagcccttcagggaaatccgatcgattgggttagcacgcatagatatcaccatcaa
ttttgcgattccgaaagagacccgcatagtccaattgaaggcttttggtttagtcatatg
agttggttgtttgataccaattctgtggttgagaggtgtggagagccaaacaatgttggg
gatttggaaaagcaaccattttacaagttcattcaaactacttatcttcttcatccaatt
gctcttggtgctttactctattcaatgggtggatttcctttcattgtttggggaatgggt
gtgagaatagtgtgggtgtaccatatcacttggctggtgaattcagcttgccatgtttgg
ggaagtcaagcttggaaaacaggagatttatctaggaacaactggtgggtggcattgctt
gcatttggagagggatggcacaacaaccaccatgcattcgagttctcagcccgacatggc
ctagagtggtggcagctcgacatgacatggtacgttgttcggcttcttcaagctattggt
ttggccacagatgtgaagataccaacacaacttcagaaagaaaaattggcaatcatcaac
accacatga

DBGET integrated database retrieval system