KEGG   Cucumis sativus (cucumber): 101210229Help
Entry
101210229         CDS       T02486                                 

Definition
palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic-like
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:csv01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:csv01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 380 aa AA seqDB search
MALLNSKFHRFPSLRPSIHRSPLPTLNFPSIPHDQLPFHFVGRPNFNSLRLNSPIHIQNR
AISSPTEAFEPESLPPPPASAVDGRRILLSDVVVKRRREVFWGRKWNSLDIGTAGVVVAT
HLLTLFAPFQFNWAAFWVAISLYIITGLFGITLSFHRNLSHRSFKLPKWLEYLFAYCGVQ
ALQGNPIDWVSTHRYHHQFCDSERDPHSPIEGFWFSHMSWLFDTNSVVERCGEPNNVGDL
EKQPFYKFIQTTYLLHPIALGALLYSMGGFPFIVWGMGVRIVWVYHITWLVNSACHVWGS
QAWKTGDLSRNNWWVALLAFGEGWHNNHHAFEFSARHGLEWWQLDMTWYVVRLLQAIGLA
TDVKIPTQLQKEKLAIINTT
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggctcttctcaattctaaattccaccgcttcccatctctccgcccttcaatccaccgt
tcacccctccccacccttaattttccctccattccccatgaccaattaccctttcatttt
gtgggtcgtcctaatttcaattccctgaggttgaattccccaattcatatccaaaacaga
gcaatttcttcgccgacagaagcatttgagccagagtcgttgccgccgccaccggcgtcg
gcggtggatgggaggaggattttgttgtcggacgtagtggtgaagcggcggagggaagtg
ttttggggaaggaaatggaattcgttagatatcggaacggctggagtggtggtggcgacg
catttacttacactttttgctccttttcaattcaattgggctgcattttgggtggcgatt
tctttatatataatcactggtctattcggtattaccctatcatttcatcggaatctctct
catcggagctttaaacttcctaaatggctcgaatatctcttcgcatattgtggagttcaa
gcccttcagggaaatccgatcgattgggttagcacgcatagatatcaccatcaattttgc
gattccgaaagagacccgcatagtccaattgaaggcttttggtttagtcatatgagttgg
ttgtttgataccaattctgtggttgagaggtgtggagagccaaacaatgttggggatttg
gaaaagcaaccattttacaagttcattcaaactacttatcttcttcatccaattgctctt
ggtgctttactctattcaatgggtggatttcctttcattgtttggggaatgggtgtgaga
atagtgtgggtgtaccatatcacttggctggtgaattcagcttgccatgtttggggaagt
caagcttggaaaacaggagatttatctaggaacaactggtgggtggcattgcttgcattt
ggagagggatggcacaacaaccaccatgcattcgagttctcagcccgacatggcctagag
tggtggcagctcgacatgacatggtacgttgttcggcttcttcaagctattggtttggcc
acagatgtgaagataccaacacaacttcagaaagaaaaattggcaatcatcaacaccaca
tga

DBGET integrated database retrieval system