KEGG   Cucumis sativus (cucumber): 101210586Help
Entry
101210586         CDS       T02486                                 

Definition
1,4-alpha-glucan-branching enzyme 2-2, chloroplastic/amyloplastic-like
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101210586
Enzymes [BR:csv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     101210586
Exosome [BR:csv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101210586
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 876 aa AA seqDB search
MVYTISGIRFPAVPPLCKRSDSTFNGDRRMPLSLFMKKDSSPRRIFVTKSTYDSDSVSST
ATAASDKVLVPGSGSDGSSTLAGQSENYGAVSEDPQVLPDIDSQIIEAHEKTKEETDQDP
ESLPVDNIDGDQAPLEEISIPSKNKKAETTVRSIPPPGSGQRIYDIDPYLLSHRGHLDYR
YGQYIRMREAIDQNEGGLEAFSRGYEKFGFTRSATGITYREWAPGAKSAALIGDFNNWNP
NADIMSRNEFGVWEIFLPNNADGSPAIPHGSRVKIRMDTPSGIKDSIPAWIKFSVQAPGE
IPYNGIYYDPPEEEKYVFQHPQPKKPKSLRIYESHVGMSSTEPIINSYANFRDDVLPRIK
KLGYNAVQIMAIQEHSYYASFGYHVTNFFAPSSRCGTPEELKSLIDRAHELGLLVLMDIV
HSHASKNVLDGLNMFDGTDGHYFHSGSRGYHWMWDSRLFNYGSWEVLRYLLSNARWWLEE
YKFDGFRFDGVTSMMYTHHGLEVGFTGNYSEYFGFATDVDAVVYLMLVNDMIHGLYPEAV
TIGEDVSGMPTFCIPVQDGGIGFDYRLHMAIADKWIELLKKSDEDWEMGEIVHTLVNRRW
LENCVAYAESHDQALVGDKTVAFWLMDKDMYDSMALDRPSTPAIDRGIALHKMIRLITMG
LGGEGYLNFMGNEFGHPEWIDFPRGDQHLPGGAVIPGNNFSYDKCRRRFDLGDADYLRYH
GMQEFDRAMQHLEESFGFMTAGHQYVSRKDDRDKIIVFERGDLVFVFNFHWSNSYYDYRV
GCLKPGKYKIVLDSDDPLFGGYNRLDHSAEYFTFEGNYDNRPRSFLIYAPSRTAVVYALA
PDDSELANGETEAITETETESETETETETETETSLE
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atggtttatacgatctcagggattcgcttccctgcagttcctccgctctgcaagcgctcc
gactccaccttcaatggcgacagaaggatgccgctatctctcttcatgaagaaagactca
tctcctaggaggatttttgtgaccaagtctacttatgattctgattccgtctcgtcgact
gcaactgctgcttctgataaggttttagttcctgggagtgggagcgatggttcttcgact
ttggctgggcagtctgaaaattatggcgcagtttccgaggatcctcaggtgctccctgac
atagatagtcaaataatagaagctcatgagaagacaaaggaagaaacagatcaagatcct
gaatcattgccagtagacaatattgatggtgatcaagcaccactggaggagatatcaatc
ccttcaaaaaataagaaggctgaaaccaccgtgaggtccattcctccacctggcagcgga
cagagaatttatgatatagatccatatttgttgagtcacagaggacatcttgattaccga
tatggacagtacataaggatgagggaggctattgaccagaatgaaggtggtttagaggca
ttctctcgtggctatgaaaagtttggtttcacacgcagtgccacaggtatcacgtacagg
gaatgggcaccaggagccaagtcagctgcattgattggagacttcaacaattggaatcct
aatgcagatattatgagccggaatgaatttggtgtctgggaaatttttttgcctaataat
gcagatggttctccagccattccccatggctctcgcgtgaagattcgaatggatactcct
tctggcatcaaagattcaattcccgcttggatcaagttttcagtgcaggctccaggtgaa
ataccatacaatggcatatactacgatccaccagaagaggaaaagtacgtatttcaacat
cctcagccaaaaaagccaaaatcacttagaatttatgagagccatgttggtatgagtagt
acggaacctattataaattcatatgcaaactttcgtgatgatgttcttcctcgcattaag
aagcttggatacaatgctgtccagatcatggctatacaagagcattcttactatgctagc
tttgggtaccatgtcaccaatttttttgctcctagcagtcgttgtggaacccctgaagaa
cttaaatctttgatagatagagctcatgagctcggattgcttgttctcatggatattgtt
catagtcacgcgtcaaagaatgtgttggatggactaaacatgtttgatggcactgatggc
cattatttccattctggatcacgaggttatcattggatgtgggattctcgcctttttaat
tatggaagctgggaagtactaaggtatctactatcaaatgcaagatggtggctggaagaa
tacaagtttgacgggttcagatttgatggtgtgacctcaatgatgtacactcatcatggc
ttggaggtagggtttactggaaactacagtgagtactttggatttgctacagatgtagat
gctgtcgtgtatttgatgctggtgaatgatatgattcatgggctttatcccgaggctgtc
acaattggtgaagatgtcagtggaatgcctaccttttgcattcctgtccaagatggtgga
attggatttgattaccgtctgcacatggccattgctgataaatggattgagcttctcaag
aaaagcgatgaagattgggaaatgggtgaaattgttcacacgcttgttaacagaaggtgg
ttagagaactgcgttgcatatgctgaaagtcatgaccaagctcttgttggtgataaaaca
gttgcattctggttgatggacaaggacatgtatgattccatggctttggacagaccgtca
actcctgcaattgatcgtggaatagcattgcataaaatgataaggcttattaccatggga
ttgggaggagaaggatatctgaatttcatggggaatgaatttggacatcctgagtggatt
gattttccaaggggcgaccagcatcttcctggtggtgcagtaattcctggaaacaacttc
agttacgataaatgtcggcgtaggtttgatttgggagatgcagattatttaagatatcat
ggtatgcaagaatttgatcgagcaatgcagcatcttgaagaatcgtttggttttatgaca
gctggacaccaatatgtttcccgaaaagacgacagagataaaatcattgtgttcgagagg
ggggatttggtttttgttttcaacttccattggagtaacagctattacgactaccgagtt
gggtgcctaaagcctggaaaatacaagattgtcttggactcggacgatccattgtttggg
ggttacaatcggcttgatcattctgccgaatacttcacatttgagggtaattatgataac
aggcctcgctctttcctcatatatgctccttccaggacggccgtggtctatgctcttgca
ccagatgattctgagcttgcaaatggtgaaactgaagccataaccgaaaccgagaccgaa
tctgaaacggaaacggaaactgaaacagaaactgaaacttcactggagtag

DBGET integrated database retrieval system