KEGG   Cucumis sativus (cucumber): 101210683Help
Entry
101210683         CDS       T02486                                 

Definition
josephin-like protein-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
csv  Cucumis sativus (cucumber)
Brite
Enzymes [BR:csv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101210683
Peptidases [BR:csv01002]
 Cysteine Peptidases
  Family C86
   101210683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 184 aa AA seqDB search
MAREDFGVYHERQKLQLCLLHALNNLFQEKDAFTRANLNAIAEKLVRDVPNQETWTPLSI
VFKPHHNTVTGNYDINVLISALEEKGKSVVWHDHRNGAFSIDLDGPDHTCKLMGIVLNVS
VRRFGGIWKSRHWVALRKIDGLWYNLDSDLPDPHPFKDTDELRQFLDHVINDNGEILLVM
NDRN
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggcgagagaggatttcggggtttatcacgagaggcaaaagctacagttgtgtctcttg
cacgctctcaataacctatttcaggaaaaggatgcatttactcgagcaaacttaaatgca
attgctgaaaagctggtgcgcgatgtgccgaaccaagaaacttggacgccattatcaatt
gtctttaagcctcatcacaacacagtaaccggaaattatgacataaatgtcctaatttca
gctctggaagagaaagggaagagtgtagtgtggcatgaccatcggaatggagctttctca
atcgatttggatggacctgatcatacttgtaaactaatgggaattgtacttaatgtctca
gttagaaggtttggtggcatttggaaaagtaggcactgggttgctttgagaaagatcgat
ggattatggtataatttggacagtgatctgccggatcctcatccatttaaggacactgac
gaattaagacaattcttggatcatgtgatcaatgacaacggggaaattttgcttgttatg
aatgacaggaactaa

DBGET integrated database retrieval system