KEGG   Cucumis sativus (cucumber): 101210778Help
Entry
101210778         CDS       T02486                                 

Definition
alpha-galactosidase-like
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    101210778
  Lipid metabolism
   00561 Glycerolipid metabolism
    101210778
   00600 Sphingolipid metabolism
    101210778
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    101210778
Enzymes [BR:csv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     101210778
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 430 aa AA seqDB search
MANRIRFGSVFLLILLLSAAYVAIAERRVSLLNGYDKSIFKSSFHRIFDTSKYGILQLQN
GLARTPQMGWNSWNFFACDINETLIKETADALVSTGLAELGYVYVNIDDCWNTQKRDSKD
QLVPDPKGFPSGIKPLADYVHSKDLKLGIYSDAGLFTCQVRAGSLYHENDDAQLFASWGV
DYLKYDNCFNLGIKPIKRYPPMRDALNATGRSIFYSLCEWGVDDPALWAGKVGNSWRTTD
DINDTWASMTTLADLNNKWAAYAGPGGWNDPDMLEVGNGGMTYQEYRAHFSIWALMKSPL
LIGCDVRNMTKETSEILMNKEVIAVNQDPLGVQGRKVKVFGKDGCLQVWAGPLSGSRLAV
VLWNRCSVASTITTDWNALGLKPNTSVSVRDLWLHEDVAGDAMSSFGAEVDPHDCKMFVF
TPVATFRAEM
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacaggataaggtttggatcagtgtttttactgattttgttactctcggcggca
tatgtggcgattgcagaaagaagagtgtcactattgaatggttacgataaatcgattttc
aagtcatcatttcatcggatttttgatacctccaagtacggcatactgcagcttcaaaat
gggttggctcgaacgcctcagatgggatggaatagctggaattttttcgcctgtgatatt
aatgaaactctaatcaaggaaactgcggatgcactcgtttctacgggtttggctgagtta
ggttatgtgtacgtcaacatagatgattgctggaacactcaaaagagagactcaaaggat
caactggttcctgatcccaagggtttcccgtcaggaattaaacctcttgctgattatgtt
catagtaaagacttgaagcttggaatatattctgatgctggtcttttcacttgtcaagtt
cgagctgggtcactttaccatgaaaatgatgatgcacagttgtttgcttcttggggggtt
gattatctgaagtatgataactgtttcaatctaggaattaaaccaataaagcgataccca
cctatgcgtgatgcactaaatgcaactgggcggagtattttctattcactttgtgaatgg
ggagttgatgatccagcattatgggccggcaaggttggaaacagttggcgtacgacagac
gacattaatgatacatgggcaagcatgactactcttgcagatctcaacaataagtgggca
gcctatgccggacctggtggctggaatgatccagatatgttggaagttggtaatggaggc
atgacttatcaggaatatcgtgctcattttagcatatgggctctgatgaagtcgcctctt
ttgatcggttgcgatgttcgaaacatgaccaaagaaacttcagaaattcttatgaataag
gaggtgattgcagtaaaccaagatcctcttggggtccagggaaggaaggttaaagttttt
ggaaaggatggttgtcttcaggtttgggcaggtcctctatctggaagccgcttggctgtt
gttctttggaatcgatgctcggttgcatcaacaatcaccacggattggaacgcacttggg
cttaaacctaacaccagcgtctcagtaagagacttgtggctgcacgaagatgttgcagga
gatgcaatgtcatcatttggagcagaagtcgaccctcatgactgcaaaatgttcgtattc
acacctgtagccacgttccgtgctgaaatgtaa

DBGET integrated database retrieval system