KEGG   Cucumis sativus (cucumber): 101211911Help
Entry
101211911         CDS       T02486                                 

Definition
uncharacterized LOC101211911
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    101211911
Enzymes [BR:csv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     101211911
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 470 aa AA seqDB search
MSMDASGEELSDLEVENGVKHCGFEDEPETIAIMDAVKVLLQGLGEDINREGIKKTPLRV
AKALREGTRGYGQTANEIIQSALFPEDGLHKGVGQAGGAGGIVIVRDIDFFSYCESCLLP
FQVKCHVGYVPSGQRVVGLSKLSRVADVFAKRLQKPQRLADQICSALQHGIKPGGVAVVL
HCLHTHFPSLESFFLDSKSPGWVKVLVQSGSGAFESQDADIWMDFFSLLKFRGTYPSKAG
ASDSNAQHWCPSQFSSASKFSTKPEPLNLKMTTAVTSILRSLGEDPSRKELLGTPGHFVN
WLMNFQNCNVEMKMDMNKLNGFANGRTHFDHNENSNLYEKQIQSQMNFLFWSQCEHHLLP
FYGVVHIGFIRDDGLTPLEKSLLNSVIHFYGFKLQVQERMTRQIAETVSSLLGTDVIVVV
EGSHTCMISRGIEKFGSTTATIAALGRFSSDAAVRSMFLQSIPQTTIGEL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatggatgcttcaggtgaagagctttcggatttggaggttgagaatggagtgaaa
cattgcgggtttgaggatgaacctgaaactattgctataatggatgctgtcaaagttttg
ttgcagggtttaggggaagatatcaacagagagggtatcaaaaagacccctcttcgtgtg
gccaaggctcttagagaaggaacaagaggctatggacagacagccaatgaaattattcaa
agtgctttatttcctgaagatggactgcataagggtgttggccaggctggaggtgcaggt
gggattgtgattgttcgagatatcgacttcttctcatattgtgagtcatgtctgcttcca
tttcaagtgaaatgtcatgtgggctatgttccatctggtcaacgagttgtagggctcagc
aagctctctcgagtggcagatgtgtttgcaaagcgacttcaaaagcctcagcgtctagct
gatcagatttgttcagctctgcaacatgggatcaagccaggaggtgttgctgttgttctt
cattgtttgcacactcatttccccagcttggagtcattctttcttgactcgaaatccccg
ggatgggtcaaagtgctggtgcaatctggttcaggagctttcgaaagccaagatgctgat
atctggatggactttttcagtcttttaaaatttagaggcacatatccgtctaaagctggg
gcatcagattcaaatgctcaacattggtgcccatctcaattttcttcagcttctaaattc
tctaccaaacccgaaccgctaaatctaaaaatgaccactgcagtgacatctattttgagg
tcgttaggtgaagatccatcaagaaaagagcttcttggaacacctggtcactttgtgaac
tggctaatgaacttccaaaactgtaatgtggaaatgaagatggatatgaacaagctcaat
ggctttgctaatggtagaactcatttcgatcacaacgagaacagtaacctctacgagaaa
cagattcaatcacagatgaatttcttgttctggtctcaatgtgagcaccatttgctcccc
ttctacggcgttgtccatataggattcataagagatgatggactcactccccttgagaaa
tcacttttaaactcagtaatacatttttatgggtttaagcttcaagtacaggaaagaatg
accaggcagatagcagagacggtttcatcattattaggaacagacgtgatagttgttgtg
gagggaagtcatacctgtatgatctcaagaggaattgagaagttcggtagcacaacagct
acaattgctgcgcttggtcggttttcatctgatgcagctgtaaggtccatgttcttgcag
agcattccacaaactaccattggagaactgtaa

DBGET integrated database retrieval system