KEGG   Cucumis sativus (cucumber): 101212019Help
Entry
101212019         CDS       T02486                                 

Definition
non-lysosomal glucosylceramidase-like
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:csv00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:csv00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 951 aa AA seqDB search
MSEGKKLGNGLVEQDEDINKSLTEKTGIDPGQTPSLTWQRKLNREGTSLWQFRLHLKEII
HLAPVGYRLFRYIREESVKGRGAMINPFIRRRITDTHAIPLGGLGSGSIGRSYRGEFQRW
QLFPRKCEDKPILANQFSVFVSRPNAEKYSTVLCAQSPETQREVESSGIGSWDWNLKGHS
STYHALYPRAWTIYDGEPDPELRIVCRQISPVIPHNYKESSYPVSVFTFTLHNSGKTDAD
VSLLFTWANSVGGLSEYSGNHINSRTKKKDGVHTVLLHHKTASGFPPVTYAIAAQEGNGV
HVSDCPCFVISGNSQGISAKDMWLEIKEHGSFDRLKFADMSMPSEVGSSIGAAVSASVTV
SSDSVRTVTFSLSWDCPEVNFCRGKTYHRRYTKFYGNLGDAAADIARDAILEHHHWESQI
DAWQRPVLEDKRFPKWYPVTLFNELYYLNAGGTIWTDGSLPIQSLVSIGERGFCLDQCRS
GDSVIYESHENDTANDILGRMTSRLDELRDSVASNSAFGVNLLQKGEENVGQFLYLEGVE
YTMWNTYDVHFYSSFAIIMLFPKLELSIQRDFAAAVMMHDPSKMQLLDNGKWEARNVLGA
VPHDIGVNDPWFEVNGYNLYNTDRWKDLNPKFVLQIYRDVVATGDMKFAKAVWPPVYLAI
AYMDQFDRDGDGMIENDGFPDQTYDTWSVSGVSAYSGGLWVAALQAASALARVADEKDAE
HYFWFKFQKAKRAYEKLWNGSYFNYDSSGGSSSSSIQADQLAGQWYARASGLLPIVDEDK
AKSALAKVYNYNVMKVKDGKRGAVNGMLPDGTIDFSSMQSREIWSGVTYAVAASMIHEDM
TDMAFRTAEGIHEAAWSEDGLGYNFQTPEAWTTTDRYRSLCYMRPLAIWAMQWAFSEKVS
VIEELKELDSDAISRHHARFSKVARYLKLPEDGTSSSVLQTVYDYTLKRFF
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaggcaagaagttgggaaatggcttggttgagcaagatgaggacatcaataaa
tctctaactgaaaagactggcattgatccagggcaaactccatcactcacctggcaaaga
aaattaaacagggaaggaacttcactttggcagttcaggttgcatctgaaagagataatt
catctggctccagtagggtataggctattccgctatatacgagaagaatctgtcaaagga
aggggggctatgataaatccttttatcagacgtcgtataactgatactcatgccattcct
ctaggtggtcttggatcaggaagcattggaagaagttaccgaggtgaatttcaacgatgg
caactattccctagaaaatgtgaagataagccaattttagcaaatcaattttctgttttc
gtctcacgaccgaacgctgagaagtattctactgtactatgtgcacagagccctgaaact
cagagggaagttgaatcatcaggcattggatcttgggattggaatttgaagggtcatagc
tctacatatcatgctctgtatcctcgagcttggacgatatatgatggtgaaccggatcca
gaacttagaatagtttgccgtcagatttcacctgttattcctcataattacaaggagagc
agttaccctgtctcagtttttactttcacgctgcataattctggaaaaacagatgctgac
gtcagtttgcttttcacctgggcaaattcagttggagggctttctgagtattctggtaac
catatcaattcgagaacaaagaagaaagatggcgtgcatactgtgcttctacatcacaag
acagcaagtggatttccccctgtgacgtatgctattgccgctcaagagggcaatggggtt
catgtctcagattgcccttgttttgtaatatctggtaattcccagggtatatcagccaag
gatatgtggcttgagatcaaagagcatggatcgtttgatcggcttaaatttgctgatatg
tcaatgccctctgaagtgggttcgtccattggtgcggccgtttcagcttcagttacagtt
tcatctgattctgttcgtactgtgacattttcgttgtcatgggactgtcctgaagtgaac
ttttgtagaggaaaaacttatcacaggcgttacacaaaattctatggtaaccttggtgat
gctgctgccgatattgcacgtgatgctatactagaacatcatcactgggaatctcaaatt
gatgcttggcaaagacctgttcttgaagacaagaggtttccaaaatggtatcctgttact
ctctttaatgagctttattatctaaatgcaggagggacaatctggacagatgggtcgctt
ccaattcagagtttagtaagcataggggaaagaggattttgccttgatcaatgcagatct
ggtgatagtgtaatttatgagtcccatgaaaatgacactgctaatgatattcttgggagg
atgacttcaagacttgatgagttacgtgattcagtcgcgtcaaattctgcatttggagta
aatctgcttcaaaagggggaggagaatgttgggcagttcctttaccttgaaggggttgaa
tacacaatgtggaatacctatgacgttcatttttactcctcttttgcaataataatgcta
tttccaaaactcgaactcagcattcaacgagattttgcagcagcagtgatgatgcatgat
cccagcaagatgcaacttcttgataatggaaaatgggaagcaagaaatgttcttggagct
gttcctcatgacatcggagttaatgatccatggtttgaagtgaatggatataatctatat
aatacagataggtggaaggacttgaatccaaaatttgtcctccaaatttatagggatgtt
gttgccacaggggatatgaaatttgcaaaggctgtctggccccctgtctaccttgccata
gcttatatggatcagttcgatcgagatggtgatgggatgattgagaatgatgggttcccc
gatcagacttatgatacgtggtctgtctctggtgttagtgcatatagtggtggcttatgg
gtggcagcgttgcaggctgcttcagccctggctcgtgtagccgatgaaaaggatgctgag
cactatttttggttcaaatttcagaaggcaaaacgtgcctatgagaaattgtggaatggt
tcttacttcaactatgacagtagtggcgggagttcaagttcatccattcaagctgatcag
ttggctggacaatggtatgcgagagcttcaggtcttcttcccattgttgatgaagacaag
gccaaaagtgcactggcgaaggtatacaattacaatgtcatgaaggtgaaggatgggaag
cgaggtgctgtaaatgggatgcttccagatggaacgatagacttttcttcaatgcagtca
agagaaatatggtcaggagtgacatacgcggttgctgcttcaatgatccatgaagatatg
actgacatggcatttcgaacagcagaaggcatccatgaagctgcatggtcagaagatggc
cttggatacaactttcagacaccagaagcttggacaacaacggatcggtacagatcattg
tgttacatgcgacctcttgcgatttgggcgatgcaatgggcattttcagaaaaagtatct
gtcattgaggagttgaaagaactcgatagcgatgccatatcaagacaccatgctaggttt
tcaaaagttgcccgctatttgaagttgcctgaagatgggacatcttcaagtgttctacaa
accgtctatgattacacccttaagaggtttttctag

DBGET integrated database retrieval system