KEGG   Cucumis sativus (cucumber): 101212931Help
Entry
101212931         CDS       T02486                                 

Definition
NADH--cytochrome b5 reductase 1-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:csv00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 280 aa AA seqDB search
MEVLQALDSQVLIGLAAALVAIVVGAVFLFSSRKPASRACLDPEKFKEFKLVKRTKLSHN
VAKFTFILPKTDSILGLPIGQHLSCRGKDSQGEEVIKSYTPTTLDSDVGYFELVIKMYPQ
GRMSHHFREMRLGESLAVKGPKGRFKYQPGQVSAFGMLAGGSGITPMYQVSRAILENPDD
KTKVHLIYANVTLEDILLKEELDLLAKRYPDRFKIYYVLNQPPEVWDGGVGFVSKEMIKA
HCPAPAADIKILRCGPPPMNKAMGEHLDALGYSPEMQFQF
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggaggttttacaggcacttgattctcaggttctcattggtttagcagcggcgttggtt
gccattgttgttggtgctgttttcctgttttcctccagaaaacccgcatccagagcctgc
ttggatcctgagaagtttaaggagtttaagcttgtgaagcgtactaagctgagccacaat
gtggcgaagttcacttttatacttcccaagactgattcaattcttggtcttcctattgga
caacatttaagttgcagggggaaggatagccaaggtgaagaagttattaaatcttacacc
ccaactactttggattcggatgttggatattttgaactagtcataaagatgtatccccaa
ggcaggatgtcacatcattttcgagaaatgcgtctcggggaatcccttgctgtaaaggga
ccaaagggacgtttcaagtaccaacctggtcaagttagtgcatttgggatgcttgctgga
ggctctggcattacacctatgtaccaagtttctcgcgctatattagagaacccagacgac
aagacaaaggttcaccttatttacgccaatgttactctagaagatattctgttgaaggag
gaattggatctccttgccaaaagataccctgatcgcttcaagatctactatgtgttgaac
cagcctcctgaagtttgggatggcggcgttggctttgtatctaaggaaatgattaaagca
cattgccctgcaccagctgctgacattaagattctacgatgcggtccgccaccgatgaac
aaggccatgggcgagcaccttgacgctcttggatattcacctgaaatgcagtttcagttc
taa

DBGET integrated database retrieval system