KEGG   Cucumis sativus (cucumber): 101213654Help
Entry
101213654         CDS       T02486                                 

Definition
ribokinase-like
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    101213654
Enzymes [BR:csv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     101213654
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 370 aa AA seqDB search
MNTISRSPLPENFLALPIKSTKIPSPRIQFTSPQNPFNSRPPVPRFSIDSSKSPTPVIPV
EPPPLVVVGSANADIYVEIDRLPEEGETISAKSGQTLAGGKGANQACCGGKLEYPTYFVG
QVGKDAHGKLITAALEDGGVRLDHLATVAAAPTGHAVVMLQSGGQNSIIIVGGANMNCWP
DALSDSDLEVIRNAGIVLLQREIPDSVNIQVAKAARSAGVPVILDAGGVDAPIPQELLDH
VDIFSPNESELSRLTGCPTESFEQIGQAVEKCYKMGVKQVLVKLGDKGSAFFTQGEKPIR
QSIISAAEVLDTTGAGDTFTASFAVALVEGKSKEECLKFAAAAASLCVQVKGAIPSMPDR
ESVRNLLQSV
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaatttcacgctcgccattgccggaaaacttcctcgcactacccattaagtcc
accaaaatcccttccccacgtattcaattcacaagtccacaaaaccctttcaattctaga
cccccagttccccgtttctccatcgattcatccaaatccccaactccagtgatccccgtc
gagccaccgccgttggtcgtcgtcggctcggccaatgctgacatttacgtggagatcgac
cggctaccggaggagggagagactatctccgctaaaagtggccagactctggctggcggc
aagggggccaatcaggcctgctgcggtggcaagctcgagtacccaacttactttgtgggt
caggttggcaaggatgctcatgggaagctgatcacggcggcgcttgaggatggtggcgtc
cggcttgatcatttggctactgtggcggcagcgccgacggggcacgcggtagtgatgtta
cagtctggcgggcagaattctatcatcattgttggtggtgctaatatgaattgttggcct
gatgcgttatctgatagtgatttggaggttataagaaatgctgggatcgttttgctacag
agggagattcctgattcagtcaatatccaagttgcaaaggctgccaggagtgctggggtt
ccagttattttggatgctggtggagttgacgctcctatcccacaagaactgcttgaccat
gttgatatttttagtccaaatgaaagtgagctaagtcgcctaacaggatgcccaactgaa
agcttcgaacaaattggacaagctgtagaaaaatgctataaaatgggtgtcaagcaagtt
cttgtaaaactcggggacaaaggatctgctttttttacccaaggggaaaaaccaatcaga
caatccatcatatcagctgcggaggtacttgatactactggagctggtgatacttttacc
gcatcttttgctgtggcactcgttgaaggaaagtcaaaggaggaatgcctgaaatttgcg
gctgctgcggcctcactttgtgttcaagtgaagggagccattcccagcatgcctgatagg
gaatcagtgcggaatctccttcagtctgtttga

DBGET integrated database retrieval system