KEGG   Cucumis sativus (cucumber): 101214114Help
Entry
101214114         CDS       T02486                                 

Gene name
ICL, Isocitrase
Definition
isocitrate lyase-like
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:csv01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:csv00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 576 aa AA seqDB search
MAASFSVPSMIMEEEGRFEAEVAEVQAWWNSERFKLTRRPYTAKDVVSLRGSLRQSYASN
DLAKKLWRTLKTHQANGTASRTFGALDPVQVTMMAKHLDTIYVSGWQCSSTHTSTNEPGP
DLADYPYDTVPNKVEHLFFAQQYHDRKQREARMSMSREERAKTPYIDYLKPIIADGDTGF
GGTTATVKLCKLFVERGAAGVHIEDQSSVTKKCGHMAGKVLVGVSEHINRLVAARLQFDV
MGVETILVARTDAVAATLIQTNVDKRDHQFILGATNPNLRGKSLAGALAEAMAAGKTGAE
LQALEDQWISMAQLKTFSECVTDAIMNTNATENEKRRKLDEWMNHSSYEKCISNEQGREI
AEKLGLKNLFWDWDLPRTREGFYRFKGSVMAAIVRGWAFAPHADLIWMETSSPDLVECTT
FAKGMKSIHPETMLAYNLSPSFNWDASGMSDKQMEEFIPRIARLGFCWQFITLAGFHADA
LVVDTFARDYARRGMLAYVERIQREERNNGVDTLAHQKWSGANYYDRYLKTVQGGISSTA
AMGKGVTEEQFKESWTREGAVNLGEEGNVVVAKSRM
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctccttctctgttccttcgatgataatggaagaagaaggaagatttgaagcg
gaagttgcagaggttcaggcatggtggaattcagagaggttcaagctaacacgacggccg
tacacggcaaaagacgtggtgtcactacgtgggagcctgagacaaagctacgcttcaaac
gatttagctaagaagctgtggcgaaccctcaaaacccaccaagctaacggcacagcctcg
aggacattcggagctcttgaccctgttcaagtgacgatgatggctaagcatttggacacc
atttatgtctccggttggcaatgttcttcaactcacacctccactaacgaacctggcccg
gacctcgccgattacccatacgacactgttccgaacaaggtcgagcatcttttcttcgct
caacagtaccatgacaggaaacagagggaagccaggatgagtatgagtcgagaggaacga
gccaaaactccttacatcgactatctcaaaccgattatcgccgacggtgacaccggcttc
ggcggcaccaccgctacagtgaagctctgtaagctatttgtggaacgcggtgccgccggt
gttcatattgaggatcaatcctctgttacgaagaaatgcggtcatatggcgggaaaagtg
ttggtaggggttagcgaacacatcaatcggctcgtagcggctcgattgcagttcgatgtg
atgggggttgagacgattctcgtggctcgaacggatgcggttgcagctactttgattcaa
acgaatgttgataaacgagaccatcaatttattttgggggcgacgaacccaaatttgaga
gggaagagtttagctggggctttagcagaagccatggcggctggaaaaacaggagcggag
cttcaagctctagaagatcaatggatttccatggcccaattgaaaacattttcggaatgt
gtaacggacgcaatcatgaatacaaacgcaacagagaatgaaaagaggaggaaattagac
gaatggatgaaccattccagttacgagaaatgtatatcgaacgaacaaggacgtgaaatc
gcagagaaattaggactgaagaatctcttctgggattgggatttaccaagaactagagaa
gggttttacagattcaaaggttcggtaatggcggcgattgttcgtggttgggctttcgca
ccacatgcagacttaatctggatggaaacttcaagcccagatttggttgaatgcacaaca
ttcgcaaaagggatgaaatccatacatccagaaacaatgttagcttataatctatcccca
tctttcaactgggatgcatcaggaatgagcgataagcaaatggaagagttcatcccgagg
atcgcgaggctgggtttctgctggcagttcataacactggcgggattccacgcggatgcg
ttggtggtggacacatttgcaagagattacgcgagaaggggaatgttggcatacgtggag
agaattcaaagagaagaaagaaacaatggagtggatacattggcacatcagaaatggtct
ggtgctaactactacgatcggtatctgaagacggttcagggggggatttcgtccaccgcg
gccatgggaaaaggggtaacggaagagcagttcaaggagtcatggacgagggaaggagca
gtgaacttgggagaagaagggaatgtggtggtagccaagtccagaatgtaa

DBGET integrated database retrieval system