KEGG   Cucumis sativus (cucumber): 101214254Help
Entry
101214254         CDS       T02486                                 

Definition
(RefSeq) mitogen-activated protein kinase 4-like
  KO
K20600  
mitogen-activated protein kinase 4 [EC:2.7.11.24]
Organism
csv  Cucumis sativus (cucumber)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 383 aa AA seqDB search
MATKESSSTTATEGKIKGVLTHGGRYVQYNVYGNLFEVSAKYVPPLRPIGRGAYGLVCAA
VNSETHEEVAIKKIGNAFDNIIDAKRTLREIKLLCHMEHENIIAIRDIIRPPKREVFNDV
YIVYELMDTDLHQIIRSDQPLTDDHCQYFLYQLLRGLKYVHSAKVLHRDLKPSNLLLNAN
CDLKIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDVWSVGCILGEIMTR
EPLFPGKDYVHQLRLITELLGSPDDASLGFLRSDNARRYVKQLPQYRKQQFSARFPNMSP
SALDLLEKMLVFDPNKRITVEEALCHPYLQSLHDINDEPVCARPFNFDFEQPSCTEEHIK
ELIWKESVRFNPDESARRTTLCV
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggctactaaagaatcgagttctaccactgccactgaaggcaagattaaaggcgttctt
actcatggtgggcgatatgtgcagtataatgtgtacggtaacttgtttgaggtttcagcc
aagtatgttcctcctttgcgacctattggtagaggtgcttatggtcttgtttgtgctgct
gtaaattcagagacccatgaagaggttgccatcaagaaaattggaaatgcatttgataac
ataatcgacgccaaaaggacattgagagaaattaagcttctttgccacatggaacatgaa
aatattattgctattagagacatcattaggccgccaaaaagagaggtttttaatgatgtg
tatattgtttacgaattgatggacactgatcttcatcaaataattcgttctgaccaacca
ctgacggatgatcattgccagtactttttatatcagttattgcgtgggctgaaatatgta
cactcggccaaggtcctgcaccgtgatctcaagccgagcaacctgcttctgaatgcaaat
tgcgaccttaaaattggagactttggattggcaaggacgacttctgaaaccgacttcatg
actgaatatgtggttactcgctggtaccgagcaccagaattgctcctcaattgttcagaa
tacactgctgctattgatgtttggtctgtaggatgcatacttggtgagataatgaccaga
gaacctctcttccctggcaaagattatgttcatcaactcagacttataactgagctacta
ggatcaccagatgatgccagcctaggatttctccgaagtgataatgctcgaagatatgtc
aagcagcttccacaatacagaaaacaacaattctcagctagatttcccaacatgtctcca
tctgccctcgatcttctcgaaaagatgctcgtatttgatcccaacaaacgcatcacagtg
gaggaagcactttgtcacccatacttgcaatctcttcacgacatcaatgacgagccagtc
tgtgccaggcctttcaattttgatttcgagcaaccgtcgtgcactgaagagcatattaaa
gaactgatctggaaagaatccgtgaggttcaaccccgacgaatccgctaggaggacgact
ctttgcgtttga

DBGET integrated database retrieval system