KEGG   Cucumis sativus (cucumber): 101214254Help
Entry
101214254         CDS       T02486                                 

Definition
(RefSeq) mitogen-activated protein kinase 4-like
  KO
K20600  
mitogen-activated protein kinase 4 [EC:2.7.11.24]
Organism
csv  Cucumis sativus (cucumber)
Pathway
MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:csv00001]
 Environmental Information Processing
  Signal transduction
   04016 MAPK signaling pathway - plant
    101214254
Enzymes [BR:csv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101214254
Protein kinases [BR:csv01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   101214254
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 383 aa AA seqDB search
MATKESSSTTATEGKIKGVLTHGGRYVQYNVYGNLFEVSAKYVPPLRPIGRGAYGLVCAA
VNSETHEEVAIKKIGNAFDNIIDAKRTLREIKLLCHMEHENIIAIRDIIRPPKREVFNDV
YIVYELMDTDLHQIIRSDQPLTDDHCQYFLYQLLRGLKYVHSAKVLHRDLKPSNLLLNAN
CDLKIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDVWSVGCILGEIMTR
EPLFPGKDYVHQLRLITELLGSPDDASLGFLRSDNARRYVKQLPQYRKQQFSARFPNMSP
SALDLLEKMLVFDPNKRITVEEALCHPYLQSLHDINDEPVCARPFNFDFEQPSCTEEHIK
ELIWKESVRFNPDESARRTTLCV
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggctactaaagaatcgagttctaccactgccactgaaggcaagattaaaggcgttctt
actcatggtgggcgatatgtgcagtataatgtgtacggtaacttgtttgaggtttcagcc
aagtatgttcctcctttgcgacctattggtagaggtgcttatggtcttgtttgtgctgct
gtaaattcagagacccatgaagaggttgccatcaagaaaattggaaatgcatttgataac
ataatcgacgccaaaaggacattgagagaaattaagcttctttgccacatggaacatgaa
aatattattgctattagagacatcattaggccgccaaaaagagaggtttttaatgatgtg
tatattgtttacgaattgatggacactgatcttcatcaaataattcgttctgaccaacca
ctgacggatgatcattgccagtactttttatatcagttattgcgtgggctgaaatatgta
cactcggccaaggtcctgcaccgtgatctcaagccgagcaacctgcttctgaatgcaaat
tgcgaccttaaaattggagactttggattggcaaggacgacttctgaaaccgacttcatg
actgaatatgtggttactcgctggtaccgagcaccagaattgctcctcaattgttcagaa
tacactgctgctattgatgtttggtctgtaggatgcatacttggtgagataatgaccaga
gaacctctcttccctggcaaagattatgttcatcaactcagacttataactgagctacta
ggatcaccagatgatgccagcctaggatttctccgaagtgataatgctcgaagatatgtc
aagcagcttccacaatacagaaaacaacaattctcagctagatttcccaacatgtctcca
tctgccctcgatcttctcgaaaagatgctcgtatttgatcccaacaaacgcatcacagtg
gaggaagcactttgtcacccatacttgcaatctcttcacgacatcaatgacgagccagtc
tgtgccaggcctttcaattttgatttcgagcaaccgtcgtgcactgaagagcatattaaa
gaactgatctggaaagaatccgtgaggttcaaccccgacgaatccgctaggaggacgact
ctttgcgtttga

DBGET integrated database retrieval system