KEGG   Cucumis sativus (cucumber): 101214582Help
Entry
101214582         CDS       T02486                                 

Definition
protein disulfide isomerase-like 1-4-like
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:csv00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101214582
Enzymes [BR:csv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101214582
Exosome [BR:csv04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101214582
  Exosomal proteins of colorectal cancer cells
   101214582
  Exosomal proteins of bladder cancer cells
   101214582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 583 aa AA seqDB search
MATRTLLLLAMAALLLFSNSVLCKDDSPPKDPLSKPTDDDDEDLSFLEEPDEAHAHQNLP
DFDNFEGGAEDEDFGDFTDFEDAEGDGDEYKAPVVDEKDVVVLKEGNFSDFIKKNRFVMV
EFYAPWCGHCQALAPEYAAAATELKAENVALAKVDATEENELAQQYDVQGFPTVYFFSDG
VHKAYPGQRTKDAIVSWIKKKTGPGIYNITSVEDAERILTSESKVAVGYLNSLVGSESDE
LAAASRLEDDVNFYQTVDPEVAKLFHIEASAKRPALVLLKKEAEKLSRFDGEFSKSAIVE
FVFANKLPLVTMFTKENAPLIFESSIKKQLILFAISNDTEKLIPIFEEAAKSFKGKLIFV
YVEIDNEEVGKPVSEYFGVNGNGPEVLGYTGNEDSKKFVLDKEVTLENIKAFAENFLEDK
LKPFYKSDPIPETNDGDVKIVVGDNFDEIVLDESKDVLLEIYAPWCGHCQALEPTYNKLA
KHLHGVDSLVIAKMDGTTNEHPRAKSDGFPTILFFPAGNKSFDPITVDTDRTVVAFYKFL
KKNASIPFKLQKPVSSPKAESSEGKSSDDAKESPKSTDLKDEL
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggctactcgaactcttcttcttcttgctatggctgctcttcttctcttctccaactcc
gttctttgtaaagatgattctcctcccaaagatcctctctccaagcctaccgacgacgat
gacgaagatctaagcttccttgaggagccggatgaggctcatgctcatcagaatctccct
gattttgataattttgaagggggagctgaggatgaagattttggagacttcaccgatttt
gaagatgcagaaggtgatggagacgagtacaaggcaccggtggtggatgaaaaggacgtt
gttgtcttgaaggaaggtaacttcagcgatttcatcaagaagaatcggtttgttatggtg
gagttttatgctccatggtgtggtcattgccaagcgttggctcctgaatacgcggctgcg
gctactgaattgaaggcggagaatgtggctttggcgaaggttgatgcaacagaggagaat
gaattggcgcagcagtacgatgttcaaggatttcctaccgtttatttcttctctgatggt
gtccacaaggcttatcctggacagaggacaaaggatgctatagtatcatggatcaagaag
aagaccggacctggtatttacaacataacttcggttgaagatgctgaacgcattctgact
tcggaatctaaggtcgctgttggttacctgaactccttggtgggctctgagagtgatgag
cttgctgctgcttccagactggaagatgatgtcaacttttaccaaacggtggatcctgaa
gtggcaaagcttttccacattgaagcttccgcaaaacgccctgccttggtattgcttaag
aaggaggctgaaaaactgagccgctttgatggcgagttttcgaagtctgcaattgttgaa
tttgtatttgccaataagcttcctttagttacaatgtttactaaagaaaatgcaccattg
atttttgaaagttcaattaagaaacagttaattctatttgcaatttcaaatgacacagag
aaactcatccccatatttgaagaagcagccaagtcttttaaaggaaagcttattttcgtt
tatgtggagattgataatgaggaggttggaaagccagtatcagaatattttggcgttaat
ggcaatggtccagaggttcttggatacactggaaatgaggacagcaagaaattcgtgctt
gataaggaagttaccttggaaaatattaaggcttttgcagaaaatttcttggaagacaag
ctaaaacccttctataagtcagatcccattcccgagactaatgatggtgacgtgaaaata
gtggttggagacaactttgatgaaattgttttagatgaatcgaaggatgttctccttgag
atttatgctccttggtgtgggcattgccaagcattggaaccaacttacaacaagcttgcg
aaacatctacatggcgtcgattcactcgtcattgctaagatggatggcacaacaaatgaa
catccccgggcgaagtcggatggattcccaacaattctattcttccctgctggaaataag
agctttgatcctatcacggttgatacggatcggacggttgtagcattttacaaattccta
aagaaaaatgcatcaatcccttttaagctacagaagccagtttcaagtccaaaagctgaa
agttctgaaggcaaatctagtgatgatgcaaaagagagcccaaagagcactgacttaaag
gatgaattgtga

DBGET integrated database retrieval system