KEGG   Cucumis sativus (cucumber): 101214667Help
Entry
101214667         CDS       T02486                                 

Definition
protoporphyrinogen oxidase, chloroplastic-like
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    101214667
Enzymes [BR:csv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     101214667
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 549 aa AA seqDB search
MATGSTLLTDLPFRRPHPLTLLRPSNIPSFHPLHISLQNNRLRSYFRCSIAEGSTALSPS
NASSQSSILDCVVVGAGISGLCIAQALATKHPDVAPNIIVTEAKDRVGGNITTVERDGYL
WEEGPNSFQPSDPILTMVVDSGLKDDLVLGDPDAPRFVLWNGKLRPVPAKPNDLPFFDLM
SIGGKIRAGFGALGIRPPPPGREESVEEFVRRNLGNEVFERLIEPFCSGVYAGDPSKLSM
KAAFGKVWRLEQNGGSIIGGTFKALQERNKTTKPPRDPRLPKPKGQTVGSFRKGLTMLPN
AISTCLGSKVKVSWKLSSISKVDDGGYSLTYETPEGLVSILSRSVIMTVPSYIAGTLLRP
ISGKAADALSKFYYPPVASVTISYPKGAIRKECLIDGELKGFGQLHPRSQGVTTLGTIYS
SSLFPNRAPDGRVLLLNYIGGATNTGILSQTESELIEVVDRDLRKILINPNAEDPLPLSV
RVWPQAIPQFLIGHLDVLDTAKAGLREAGMEGLFLGGNYVCGVALGRCVEGAYEAAAEVA
GFLSKKVYK
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggccaccggctccacactcctcaccgacctccctttccggcgccctcaccctctcact
cttctccgcccctcaaacattccttcttttcacccactccacatctctctccaaaacaat
cgccttcgctcctatttccgatgttcaattgccgagggctccaccgctctttccccttcc
aatgcctcttcccagtcttctatcctggattgtgtggtcgtcggtgctggaattagtggc
ctctgcatcgctcaggctcttgctaccaaacaccccgatgttgcccctaacatcattgtc
accgaggccaaggatcgcgttggaggcaacatcactacggttgagagagatggatatctc
tgggaagaaggccctaatagcttccaaccttccgatcctattctcaccatggtggtggat
agtggcttaaaagatgatttagttctgggagacccagatgcacctcgatttgtattgtgg
aatggaaagctcagaccagtgcctgcgaaacctaatgatctacctttctttgacctgatg
agcattggtggaaaaatcagagcaggctttggtgccctgggcattcgccctcctcctcca
ggtcgagaggaatcagttgaagaatttgtccgtcggaaccttggcaatgaagtttttgaa
cgtttgatagagccattttgttctggtgtatacgctggtgacccttcaaagctaagcatg
aaagcagcttttggtaaggtttggaggctagagcaaaatggtggtagtattattggtggg
actttcaaagcacttcaagaaaggaataaaactaccaaaccaccaagagatccgcgtcta
ccaaagcctaagggccaaactgttggatcttttcggaaaggacttaccatgttgccaaat
gctatttctacttgtttggggagtaaagtaaaagtatcttggaagctatctagtatcagt
aaagtggatgacggaggttatagtttgacatacgaaacaccagaaggactagtctccata
ctaagcagaagtgtcatcatgacggttccttcttatattgctggcactctgttgcgtcca
atctcggggaaagctgcagatgcactttcaaaattttattatccaccagttgcatcagtg
accatatcatatccaaaaggagcaattaggaaagaatgcttgattgatggtgaactaaag
gggtttggtcaattgcaccctcgtagccagggggtgactactttgggaactatatacagc
tcatcactttttcctaatcgagcgccagatggaagggtattgctcttgaactacattgga
ggggctactaatactggaattctttctcagacagagagcgagctcatagaagtagttgat
cgggatttaagaaaaatcctcataaacccaaacgcagaggatcctctaccattgagcgtg
agggtgtggccacaagccattccacagttcttgattggccatctcgatgttctagacacc
gccaaggccggactgagagaggctggaatggaggggctatttttaggtggaaactatgta
tgcggtgtggccttggggagatgtgttgagggtgcctatgaagctgcagctgaggtagct
ggttttctgtctaaaaaagtgtacaaataa

DBGET integrated database retrieval system