KEGG   Cucumis sativus (cucumber): 101214723Help
Entry
101214723         CDS       T02486                                 

Definition
(R)-mandelonitrile lyase-like
Orthology
K08248  
mandelonitrile lyase [EC:4.1.2.10]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Cyanoamino acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of other amino acids; Cyanoamino acid metabolism [PATH:csv00460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 573 aa AA seqDB search
MPLFPSSKKHSQALLSPSMESRISFHSQILTFLLIFSASSALPNSSQQDPDYLKFVSNAT
EFPEVDYYDYIIVGGGTAGCPLAATLSSKFRVLVLERGGVPHGNSNLMSQEGFLTTLMDD
VHSRNSPVQAFTSEEGVPNARGRILGGSSAINAGFYSRADQAFFKNSQLKWDLAIVNQSY
EWVEKEIVFKPNLKNWQSAVRDGMVEAGIIPYNGFSLDHVMGTKIGGSTFDELGRRHSAA
DLLSHATPFNIKVAIYANVERILLASTVKRRPKAIGVLYRDQIGTYHHAMLHARGEVFLS
AGAIGSPQLLLLSGIGSRPYLSSWGIPVAHHLPYVGHYLYDNPRNGISILAPMPLEQSLI
QVAGITESGTYLEAASNVIPFTSPPRSFFIRTPSPPVYLTVATLMEKITGPVASGSMRLA
STDVRVNPVVRFNYFGNAVDLERCVNGTRKIGEILRSQAMEGFKFRDWFGRKEFRYVGPA
YPEKEDEDGLVLREFCRQSVSTIWHYHGGCVAGKVVDSNYRVIGMEALRVVDGSIFGVSP
GTNPQATVMMLGRHVGLQIINQRSAVTTHRVVY
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgtttccttcttccaagaaacactcacaagctctcctctctccatcaatggag
tctcgcatttccttccactctcaaatcctcacgttcttgctcatcttttccgcttcatcc
gctcttccaaactcctctcaacaagatcccgattacctgaaatttgtgtccaatgcgacg
gaatttcccgaagtagattactacgactacataatcgtcggcggcggaacggccggttgt
ccactcgctgccacattatcaagcaaattccgagttcttgttcttgaacgcggcggcgtt
cctcatggaaactccaatctgatgtctcaggaaggattcttgacgactcttatggacgac
gtccactcacgtaactcccccgtgcaagcattcacctcagaagaaggagttcccaatgcc
agaggacgcatcctcggtggcagtagtgccattaacgctggcttctacagccgagctgat
caagccttcttcaaaaactcacaactcaaatgggacctcgccatcgtcaatcaatcctac
gaatgggttgaaaaggaaatcgtgttcaaaccaaatctcaagaactggcaatccgccgtt
cgcgacggaatggtcgaagctggaataattccgtacaacggcttcagtttagaccatgta
atgggaaccaaaatcgggggctctacattcgacgagttaggccgacgtcatagcgccgcc
gatcttctctctcacgcgacgccgttcaacatcaaagtcgccatctacgccaacgttgag
agaattctgttagcttccacagtcaaacgaagaccaaaagcaatcggtgttctttatcgt
gaccaaatcggcacgtatcatcacgctatgctacacgcacgtggagaagtattcttatca
gcaggcgcaatcggaagtccgcaattactgttactcagtggaatcggatcgcgtccatat
ctctcatcttggggcattccagtagctcatcatttaccctacgtcggccattacctctac
gacaaccctagaaacggaatttccattttagcgccgatgccattggagcagtctctaatt
caagtagccggaattacagaatcaggaacataccttgaagcagcatcaaacgtcatcccg
ttcacctcgccgccgaggtcatttttcatcagaacaccatcgccgccggtgtatctgacg
gtggcgacactaatggaaaaaataaccggaccggttgcctccggctcgatgcggctggcg
tcgacggacgtaagggtgaatccggtggtgcgattcaattacttcggaaacgcggtggac
ctggagaggtgtgtgaacgggacaaggaagattggagagattctacggagccaggcgatg
gaggggttcaaattcagggattggttcgggaggaaggaattccggtacgtggggccggct
tatccggagaaagaagatgaagatgggttggtgttgagggaattctgccggcagagtgtg
agcacgatatggcactaccatggcggatgtgtggcggggaaagtggtggattctaattat
cgggttattggaatggaggcgctgagagttgtggatggctcgatttttggggtttcgcca
ggtactaatcctcaagctacggttatgatgcttggacgacatgtcggtttgcaaattatc
aaccaacgctctgctgttacgacgcatcgtgtagtatattag

DBGET integrated database retrieval system