KEGG   Cucumis sativus (cucumber): 101214723Help
Entry
101214723         CDS       T02486                                 

Definition
(RefSeq) (R)-mandelonitrile lyase-like
  KO
K08248  (R)-mandelonitrile lyase [EC:4.1.2.10]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00460  Cyanoamino acid metabolism
csv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    101214723
Enzymes [BR:csv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.10  (R)-mandelonitrile lyase
     101214723
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GMC_oxred_N GMC_oxred_C NAD_binding_8 Pyr_redox_2 DAO FAD_binding_2 Lycopene_cycl FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 101214723
NCBI-ProteinID: XP_011659801
Position
7
AA seq 532 aa AA seqDB search
SEIYVKPDPDYLKFVSNATEFPEVDYYDYIIVGGGTAGCPLAATLSSKFRVLVLERGGVP
HGNSNLMSQEGFLTTLMDDVHSRNSPVQAFTSEEGVPNARGRILGGSSAINAGFYSRADQ
AFFKNSQLKWDLAIVNQSYEWVEKEIVFKPNLKNWQSAVRDGMVEAGIIPYNGFSLDHVM
GTKIGGSTFDELGRRHSAADLLSHATPFNIKVAIYANVERILLASTVKRRPKAIGVLYRD
QIGTYHHAMLHARGEVFLSAGAIGSPQLLLLSGIGSRPYLSSWGIPVAHHLPYVGHYLYD
NPRNGISILAPMPLEQSLIQVAGITESGTYLEAASNVIPFTSPPRSFFIRTPSPPVYLTV
ATLMEKITGPVASGSMRLASTDVRVNPVVRFNYFGNAVDLERCVNGTRKIGEILRSQAME
GFKFRDWFGRKEFRYVGPAYPEKEDEDGLVLREFCRQSVSTIWHYHGGCVAGKVVDSNYR
VIGMEALRVVDGSIFGVSPGTNPQATVMMLGRHVGLQIINQRSAVTTHRVVY
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
tctgaaatttacgtgaaaccagatcccgattacctgaaatttgtgtccaatgcgacggaa
tttcccgaagtagattactacgactacataatcgtcggcggcggaacggccggttgtcca
ctcgctgccacattatcaagcaaattccgagttcttgttcttgaacgcggcggcgttcct
catggaaactccaatctgatgtctcaggaaggattcttgacgactcttatggacgacgtc
cactcacgtaactcccccgtgcaagcattcacctcagaagaaggagttcccaatgccaga
ggacgcatcctcggtggcagtagtgccattaacgctggcttctacagccgagctgatcaa
gccttcttcaaaaactcacaactcaaatgggacctcgccatcgtcaatcaatcctacgaa
tgggttgaaaaggaaatcgtgttcaaaccaaatctcaagaactggcaatccgccgttcgc
gacggaatggtcgaagctggaataattccgtacaacggcttcagtttagaccatgtaatg
ggaaccaaaatcgggggctctacattcgacgagttaggccgacgtcatagcgccgccgat
cttctctctcacgcgacgccgttcaacatcaaagtcgccatctacgccaacgttgagaga
attctgttagcttccacagtcaaacgaagaccaaaagcaatcggtgttctttatcgtgac
caaatcggcacgtatcatcacgctatgctacacgcacgtggagaagtattcttatcagca
ggcgcaatcggaagtccgcaattactgttactcagtggaatcggatcgcgtccatatctc
tcatcttggggcattccagtagctcatcatttaccctacgtcggccattacctctacgac
aaccctagaaacggaatttccattttagcgccgatgccattggagcagtctctaattcaa
gtagccggaattacagaatcaggaacataccttgaagcagcatcaaacgtcatcccgttc
acctcgccgccgaggtcatttttcatcagaacaccatcgccgccggtgtatctgacggtg
gcgacactaatggaaaaaataaccggaccggttgcctccggctcgatgcggctggcgtcg
acggacgtaagggtgaatccggtggtgcgattcaattacttcggaaacgcggtggacctg
gagaggtgtgtgaacgggacaaggaagattggagagattctacggagccaggcgatggag
gggttcaaattcagggattggttcgggaggaaggaattccggtacgtggggccggcttat
ccggagaaagaagatgaagatgggttggtgttgagggaattctgccggcagagtgtgagc
acgatatggcactaccatggcggatgtgtggcggggaaagtggtggattctaattatcgg
gttattggaatggaggcgctgagagttgtggatggctcgatttttggggtttcgccaggt
actaatcctcaagctacggttatgatgcttggacgacatgtcggtttgcaaattatcaac
caacgctctgctgttacgacgcatcgtgtagtatattag

DBGET integrated database retrieval system