KEGG   Cucumis sativus (cucumber): 101214744Help
Entry
101214744         CDS       T02486                                 

Definition
(RefSeq) histone acetyltransferase HAC1
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
csv  Cucumis sativus (cucumber)
Brite
Enzymes [BR:csv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101214744
Transcription factors [BR:csv03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    101214744
Mitochondrial biogenesis [BR:csv03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101214744
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 1698 aa AA seqDB search
MFNMDSELYKARVFIQEKIFEILLQRHQRPIDDLQRLRFKDIVKRLEEGLFKTALTKDDY
MNLDTLESRLHSLIKRSPMNNQNQQYQQVVSSSSAISQMIPTPGMAHSGNSKMMVASSDD
SIISASASLAPMTASTGSIMQAGGINGGSFNRAEGPMTSGYQQSPSFSVGSSGVISSAGA
HRITSQMIPTPGFSNNINHASSNQSYASRDNSSNGSGLPSVESTGLSQVQLQKQHIGGQN
SRILQNLGSQMGSGIRSGLQQKSYGFTNGPANGSLGLIGGNVQLLKESSTSEGYLTVSPY
ANLTKPVQQSFDQNDKSLVQGDAYGMNNTDSFGSENLYGPATSVGSMMTAHNLNPTNLPS
MSKTSSPFSSNQSNFHGTQQGTHSPLIDGSDKMNFQPPLSSRENIIDSHTQQQFQQHHQF
QPQQQPFLQQSSVQKQQIQPQQHLLNNDSINQVQLASNLGSHVKQEPGGEHHNGPFQPQV
SEHFPLPEAHNQFHQNPSEDCVRNAQYLSVSSSQSDICSPLSQSSQQMQQFLHPHLLNSN
SQNRFSSPAGALSDATLQVQWHPQSQDRNHRQGSIVHEQNVQHDFRKKVSSHDIVQGDNL
PTEGSTIGHSFVTRTKSEPPNPLGATCQNNNSARQFINQQRWLLFLRHARRCVAPEGKCP
ERNCVTAQKLWQHLDRCSSSKCTYPRCQPTKLLLHHHKRCRDLNCPVCIPVRDYIQSRKS
VRAHNASDSSLQKLTNGFPKTCDAPDNTTRYILKTLQASETSKDLQSSLKRMKIEQSSQS
LVPKSESLAVSASAMNERHMSLDVQCQGYQQGDDTMAVKHELADVKMDVLQSSTLESHSD
LKEANAENNCSQRSDGDLVTYDEFSSLPKQENVKIENETESSMQDHSVHVTEHAAATKSG
KPKIKGVSLTELFTPEQVRDHIISLRQWVGQSKSKAEKNQAMEQSMSENSCQLCAVEKLT
FEPPPIYCTPCGARIKRNAMYHTVGAGDTRHYFCIPCYNDARGDVIVADGTTIPKSRLEK
KKNDEETEEWWVQCDKCEAWQHQICALFNGRRNDGGQAEYTCPNCYIQEIERGERIPLPQ
SAVLGAKELPRTILSDHIEQRLVKRLKHERAERARIQGKSYDEVPGADGLVIRVVSSVDK
KLEVKQRFLEIFQEENYPFEFPYKSKAILLFQKIEGVEVCLFGMYVQEFGSECQFPNQRR
VYLSYLDSVKYFRPEIKTYTGEALRTFVYHEILIGYLEYCKIRGFTSCYIWACPPLKGED
YILYCHPEIQKTPKSDKLREWYLSMLRKAAKEKIVVDLTNLFDHFFVSTGECKAKVTAAR
LPYFDGDYWPGAAEDLIYQLRQEEDGRKQNKKGMTKKTITKRALKASGQSDLSGNASKDL
LLMHKLGETISPMKEDFIMVHLQHACSHCCILMVSGNRWVCNQCKNFQLCDKCYEAEQKR
EEREKHPINQREKHALYPDEINGVPIDTKDKDEILESEFFDTRQAFLSLCQGNHYQYDTL
RRAKHSSMMVLYHLHNPTAPAFVTTCNLCQLDIETGQGWRCEVCPDYDVCNSCYQKDGGI
DHPHKLTNHPSVVDRDAQNKEARQLRVLQLRKMLDLLVHASQCRSSLCQYPNCRKVKGLF
RHGIQCKTRASGGCVLCKKMWYLLQLHARACKESQCHVPRCRDLKEHLRRLQQQSDSRRR
AAVMEMMRQRAAELNNTG
NT seq 5097 nt NT seq  +upstreamnt  +downstreamnt
atgttcaatatggactctgaactctataaagcacgtgtcttcattcaagagaaaattttt
gagattttattacagcggcatcaacggcccattgatgacctacagaggctgaggttcaag
gacattgtgaaacgcttagaggagggtctttttaaaacggctcttacaaaggatgactat
atgaacctggatactctggagagtcgtctgcacagtttgatcaagcgttcacccatgaat
aatcagaaccagcaatatcaacaagtggttagttcttcttctgcaataagtcagatgatt
ccaactcctggtatggctcacagtgggaattccaaaatgatggttgcatcttcggatgat
tctattatttctgctagtgccagcttagcacctatgactgctagcacaggaagcatcatg
caagctggtggaataaatggtggttccttcaacagagctgaaggtcccatgaccagtgga
tatcagcagtctcctagtttctcggttggttctagtggagttatatcatctgctggtgca
cacagaattactagtcaaatgattcctacaccaggtttcagtaataacattaaccatgca
agcagcaaccagtcttatgcaagcagagacaattctagtaatggtagtgggcttcccagt
gttgaatctacagggctgtctcaagtgcaattgcaaaagcagcatattggcggtcagaac
agtcgtatattacagaatcttggtagccaaatgggtagtggaataaggtctggcttacag
cagaaatcttatggctttacaaatggacctgcaaatggtagcttaggattaataggtggc
aatgtacaacttttgaaagaatctagcacctcggagggctatctgactgtctcgccttat
gctaatttaaccaaacctgtacaacaatcctttgatcagaatgacaaatcgttggtgcaa
ggcgatgcatatggaatgaataatactgactcttttggatcagaaaacctttatggccct
gcaacatctgttggatcaatgatgactgctcacaatttgaacccgacaaatttgccatct
atgtctaaaaccagttcacctttctccagtaaccagtcaaattttcatggaactcaacag
ggcactcactctcccctaattgatgggtcagataagatgaatttccaacctccactatct
tccagggaaaacatcattgattctcatacacagcagcagtttcaacaacatcaccaattt
caacctcaacaacaaccatttcttcaacagtcaagtgtccagaaacaacaaattcaacct
cagcagcatctactaaataacgattctattaatcaggttcagttagcctctaacctgggc
agtcatgtgaagcaggaacctggtggggagcatcataatgggcctttccagccacaagtt
tccgaacattttccactgcctgaggcacataaccaatttcatcagaatcctagtgaagac
tgtgtgaggaatgctcaatatctttctgtttcttctagccagagtgatatttgttcccca
ctttctcaaagctctcaacagatgcaacaatttttgcatccacacctattaaattcaaat
tctcaaaatcgttttagcagtccagctggagctctatcagatgcaactttgcaggttcaa
tggcatcctcaatcacaagatagaaatcacaggcaagggagcattgttcatgagcaaaat
gtccagcatgatttccgtaaaaaggtatccagtcacgatatagtgcagggtgataattta
cctacggaaggatcaacaattgggcactcctttgttactaggaccaagtctgagcctcct
aatccccttggtgccacctgccagaacaacaatagtgcacgccaatttataaatcagcag
agatggctcctattcttgcgacatgctcgtcgctgtgtagctcctgaagggaaatgtcca
gaacgaaactgtgtcactgctcagaaattgtggcaacatcttgatagatgcagttcttct
aaatgcacatatccccgctgccagcctaccaagttattgcttcatcatcacaagagatgt
agggatctaaactgtcctgtttgtattcctgtccgagactatatccagagccgaaagagc
gtgcgtgcccacaatgcatctgattcaagtttgcaaaagttaaccaatggattccctaaa
acctgtgatgctccagataacaccactagatatattttgaaaactcttcaggcttctgaa
acttcaaaggatctgcaatcttctcttaagcggatgaagatagagcagtcctctcagtct
cttgttcccaagagtgagagtttggcagtttcagcttctgctatgaatgaacgacacatg
tcattggatgtgcagtgccaaggttatcagcaaggtgatgatactatggctgttaagcat
gagctcgcagatgtgaaaatggatgtgctgcagagctctactcttgaaagccatagtgac
ttaaaggaagctaatgcagagaataattgcagccaaaggtctgatggtgaccttgtcaca
tacgatgagttttctagtttaccaaagcaagagaatgttaaaattgagaatgagacggag
tcaagcatgcaagatcattcagtgcatgtcactgagcatgcagcggccaccaagtctggg
aagccaaaaattaaaggggtttcactaactgaattgtttactccagaacaagtgagagac
catatcattagtctcagacagtgggttggccagagcaaatccaaggctgagaagaatcaa
gcaatggaacaatcaatgagtgagaattcctgtcaactgtgtgcagttgagaaactcact
tttgagccaccacctatatattgcacgccatgtggtgcacgtataaaacgaaatgcaatg
tatcatacagtaggtgctggtgatacacgacattatttttgtattccatgttacaatgat
gctcgtggagatgttattgttgctgatgggactaccattcccaagtcaaggctagagaag
aagaaaaatgatgaagagactgaggaatggtgggttcaatgcgataaatgtgaagcatgg
caacatcagatctgcgctcttttcaatggtcggagaaatgatggtggtcaagctgagtat
acctgtccaaattgttacattcaagaaattgaaagaggagagcgtataccattacctcag
agtgctgttcttggtgccaaagaattgcccagaacaattcttagtgatcacatagagcag
cggttggttaagagattgaaacatgaaagagctgaaagggcgaggattcaagggaaaagt
tacgatgaggttcctggagcagatgggcttgtcattagagttgtttcttccgttgacaaa
aagttggaagttaagcaaaggtttctcgaaatatttcaagaagaaaattatccatttgag
ttcccttacaaatccaaggcaattctattgtttcagaagattgaaggtgttgaagtgtgc
ctattcggcatgtatgttcaagaatttgggtctgagtgccagtttcctaatcagcgccgt
gtttatctctcataccttgattcagtaaagtatttcagacctgagattaagacgtacact
ggagaggctctccgaacttttgtttaccatgaaattctgataggatatcttgaatattgc
aaaattcggggtttcacaagctgctatatatgggcctgtcctccattgaagggtgaagat
tatatattatactgtcatccagaaatccagaaaacaccaaaatctgataaacttcgggag
tggtatttatccatgttgagaaaagctgccaaggagaaaattgttgttgatctgactaat
ctatttgatcatttctttgtctccactggtgagtgtaaggccaaggttacagcagcgagg
ctgccatattttgatggtgattattggcctggtgctgcggaggatttgatttatcaactt
cggcaagaagaggatggaagaaaacagaacaaaaaaggaatgactaaaaagacaataact
aagagagctctaaaagcatctggtcaatctgatctttctggtaatgcgtcgaaggatctg
ctactaatgcataaactcggtgaaactatttctcccatgaaggaggattttatcatggtt
catttacagcacgcttgcagtcactgttgtattctgatggtatccggaaatcgctgggtt
tgcaaccaatgcaaaaactttcagctttgtgataagtgctatgaggcagaacaaaaacgt
gaagaaagagaaaaacatcctataaatcaaagagaaaagcatgccctctatcctgatgaa
atcaatggcgtgcctattgataccaaagataaagacgagattcttgagagtgaatttttt
gacacaaggcaagcatttttgagtttgtgtcaaggaaatcattatcagtatgatactctt
cggcgagctaagcattcatcaatgatggttctttatcatcttcataatccaactgccccg
gcatttgtcacaacttgcaatctatgtcaactggatatagaaactggtcaaggttggcgt
tgtgaagtttgccctgattatgatgtatgtaattcctgttaccaaaaagatggaggtatt
gaccatcctcacaagttgactaatcatccttccgtggttgatcgagatgcacaaaataaa
gaagctcggcaactacgtgtcttgcagcttaggaaaatgctggatcttttggtgcatgca
tctcaatgtcgttcttcactttgtcaatatccaaactgtcggaaggtgaaggggcttttc
cgacatgggatacaatgcaaaacacgtgcatctggtggttgtgttctctgcaagaaaatg
tggtacctccttcaactacatgctcgagcttgcaaagaatctcaatgccacgtgccccgt
tgcagagatctcaaagagcacttaaggcggctgcagcagcagtctgattcacggagaaga
gcagctgtgatggaaatgatgagacagagagctgcagaactgaacaatacggggtaa

DBGET integrated database retrieval system