KEGG   Cucumis sativus (cucumber): 101215189Help
Entry
101215189         CDS       T02486                                 

Definition
(RefSeq) mitogen-activated protein kinase homolog MMK2
Organism
csv  Cucumis sativus (cucumber)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 370 aa AA seqDB search
MENSSFYQNIRGEPTHGGQYIQYNVYGNLFEVSRKYTPPIRPVGRGAYGIVCAALNSETN
EDVAIKKVGKAFDNRIDAKRTLREIKLLRHMDHENIIALRDIIRPPQKENFNDVYLVYEL
MDTDLNQIIRSNQSLTDDHCRYFLYQLLRGLKYVHSANVLHRDLKPSNLFLNANCDLKIG
DFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTGAIDIWSVGCILGEIMHRKPLFPG
KDYVHQLKLITELIGSPDESSLGFLRSDNPRRYFRHLPHFPKQQFSSKFPTMSPAAIDLL
EKMLVFDPTKRITVDEALCHPYLAPLHDINEEPVCPRPFSFDFEQPTYTEENIKELVWRE
SLRFNPGPAF
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacagctctttttatcagaacatcaggggagagcccactcatggtggtcaatac
attcaatacaatgtgtatgggaatctgtttgaagtttctaggaagtatactccacccatc
aggccagttgggagaggagcttatggaattgtgtgtgctgctttgaactcagaaacaaat
gaagatgttgcaattaagaaggttggcaaggcatttgacaatagaattgatgctaaaagg
accttacgagaaatcaagcttcttcgacacatggatcatgaaaatattattgctctcaga
gatattataagacctcctcagaaggagaatttcaatgatgtataccttgtttatgaatta
atggacacagatctaaatcagattatacggtccaaccaatcattgactgatgaccattgc
cggtactttctatatcagttgttacgagggctaaaatatgtgcattctgctaatgttcta
caccgtgatttgaaaccaagcaatttgttcctcaatgcaaattgtgacttaaaaattgga
gactttggccttgcaaggacaacttctgaaactgattttatgaccgagtatgttgttact
cggtggtatcgtgcacccgaattgctccttaattgttcagaatacactggagcaatagat
atttggtctgttggctgtatacttggtgaaattatgcacagaaaaccattgtttccagga
aaagactatgttcatcagctaaaacttatcactgagctcattgggtcaccagatgaatcg
agtcttggattcttacgaagtgacaatccaagaagatattttaggcatcttcctcacttc
cccaagcaacagttttcctctaaatttcccaccatgtctcctgctgctattgacttgctt
gagaagatgctagtctttgatcctactaagcgcattacagttgatgaggcgttgtgccat
ccatatttagcacctcttcatgatatcaatgaggagccagtatgtccaaggcctttcagt
ttcgatttcgagcaaccaacgtacaccgaagaaaacatcaaggaacttgtatggagggaa
tccttgaggttcaaccccggtcccgctttttga

DBGET integrated database retrieval system