KEGG   Cucumis sativus (cucumber): 101215189Help
Entry
101215189         CDS       T02486                                 

Definition
mitogen-activated protein kinase homolog MMK2-like
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
csv  Cucumis sativus (cucumber)
Brite
Enzymes [BR:csv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101215189
Protein kinases [BR:csv01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   101215189
Exosome [BR:csv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101215189
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 370 aa AA seqDB search
MENSSFYQNIRGEPTHGGQYIQYNVYGNLFEVSRKYTPPIRPVGRGAYGIVCAALNSETN
EDVAIKKVGKAFDNRIDAKRTLREIKLLRHMDHENIIALRDIIRPPQKENFNDVYLVYEL
MDTDLNQIIRSNQSLTDDHCRYFLYQLLRGLKYVHSANVLHRDLKPSNLFLNANCDLKIG
DFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTGAIDIWSVGCILGEIMHRKPLFPG
KDYVHQLKLITELIGSPDESSLGFLRSDNPRRYFRHLPHFPKQQFSSKFPTMSPAAIDLL
EKMLVFDPTKRITVDEALCHPYLAPLHDINEEPVCPRPFSFDFEQPTYTEENIKELVWRE
SLRFNPGPAF
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacagctctttttatcagaacatcaggggagagcccactcatggtggtcaatac
attcaatacaatgtgtatgggaatctgtttgaagtttctaggaagtatactccacccatc
aggccagttgggagaggagcttatggaattgtgtgtgctgctttgaactcagaaacaaat
gaagatgttgcaattaagaaggttggcaaggcatttgacaatagaattgatgctaaaagg
accttacgagaaatcaagcttcttcgacacatggatcatgaaaatattattgctctcaga
gatattataagacctcctcagaaggagaatttcaatgatgtataccttgtttatgaatta
atggacacagatctaaatcagattatacggtccaaccaatcattgactgatgaccattgc
cggtactttctatatcagttgttacgagggctaaaatatgtgcattctgctaatgttcta
caccgtgatttgaaaccaagcaatttgttcctcaatgcaaattgtgacttaaaaattgga
gactttggccttgcaaggacaacttctgaaactgattttatgaccgagtatgttgttact
cggtggtatcgtgcacccgaattgctccttaattgttcagaatacactggagcaatagat
atttggtctgttggctgtatacttggtgaaattatgcacagaaaaccattgtttccagga
aaagactatgttcatcagctaaaacttatcactgagctcattgggtcaccagatgaatcg
agtcttggattcttacgaagtgacaatccaagaagatattttaggcatcttcctcacttc
cccaagcaacagttttcctctaaatttcccaccatgtctcctgctgctattgacttgctt
gagaagatgctagtctttgatcctactaagcgcattacagttgatgaggcgttgtgccat
ccatatttagcacctcttcatgatatcaatgaggagccagtatgtccaaggcctttcagt
ttcgatttcgagcaaccaacgtacaccgaagaaaacatcaaggaacttgtatggagggaa
tccttgaggttcaaccccggtcccgctttttga

  All links  
No link information was found.   
DBGET integrated database retrieval system