KEGG   Cucumis sativus (cucumber): 101215227Help
Entry
101215227         CDS       T02486                                 

Definition
(RefSeq) acid beta-fructofuranosidase-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    101215227
   00500 Starch and sucrose metabolism
    101215227
Enzymes [BR:csv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     101215227
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
5
AA seq 685 aa AA seqDB search
MVTFNHFPTFFASGHHPENLPFYSPLPGDPLQSPSIQRRPVKRTLLISSGFFLVCLLVAI
IVQNNVDFVATFPGLSFLSSKSPEILPPVSRGVSEGVSEKANRHFIGQNLAYFPWNNSML
SWQRTAFHFQPEENWMNDPNGPLYYNGWYHFFYQYNPRAAVWGNIVWGHAVSTDLIHWLH
LPLALVPDQWYDINGVWTGSATILPDGRIMMLYTGSTKEHVQVQNLAYPANLSDPLLIDW
VKFSGNPVLVPPPGIDFRDFRDPTTAWFTSEGKWRIAIGSKVNRTGISLVYDTEDFKHFQ
LLDNLLCAVAGTGMWECLDFFPVSKDGKIGLDTSVNGPDVKHVVKTSLDDDRHDYYSLGT
YDEKTATWVPDNPKIDVGIGLRYDYGLFYASKSFFDHKKGRRVLWGWIGEADSEYADVQK
GWASLQGIPRTVLFDNKTGTNLLQWPVEEIENLRQRSHAFHNLVIHPGSVVPLEVGSSTQ
LDIFAEFELDKEAVAKAIETNVEFSCQRRGGAAIRGALGPFGLLVLADETLSEHTPVYFY
VAKGQNGTLKTFFCTDESRSSEANDVYKPIYGSSVPVLEGEKFSLRILVDHSVVESFAQG
GRTCITSRVYPTKAIYGAARLFVFNNAKDTNITASLTIWQMNPAFIRPYHPGGDHDSSKS
CVVLLPIYLFLLVSLLHLIKWDVQV
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggtgacttttaatcattttcctactttctttgcctccggtcatcacccggaaaatctt
cctttttacagtcctcttcctggcgatccccttcaatctccctccattcaacggcgaccc
gttaagcggaccctcttgatttcatctggctttttcttggtttgcttattggtcgccatt
atcgttcagaataatgtggattttgttgccacatttccaggactttcgttcttgagctcc
aagtcgccggagatattgcctccggtgtcacgtggggtgtcggaaggtgtatcggaaaag
gccaaccggcactttattggacagaatctcgcttattttccttggaataacagtatgttg
tcatggcagagaaccgcattccatttccaaccagaggagaattggatgaatgatcctaat
ggtcctctgtattacaatggttggtaccatttcttctaccagtacaatccacgtgctgca
gtgtggggaaacattgtgtgggggcatgctgtgtcaacagatttgattcattggcttcac
cttccattggccttagttccagaccaatggtatgatattaatggagtttggactggttct
gccactattcttcctgatggccgaatcatgatgctctacactggctccacaaaagagcat
gtccaagttcaaaacctggcatatccagccaacttgtctgatcctttgctcatcgattgg
gtcaaattctctggtaatccagttcttgttcccccacctggcattgatttcagggacttc
cgtgaccccacgactgcgtggttcacatccgaaggaaaatggcggatagcgattggatca
aaagtcaatagaactgggatctctttagtgtatgatactgaggacttcaaacattttcag
ttgttggacaatctgctttgtgctgttgctggtactggaatgtgggaatgtctagacttc
tttcctgtatctaaagatgggaaaattgggttggatacttcagttaatggacctgacgtg
aagcatgttgtaaagacaagccttgatgatgatcgacacgattactattcacttggaacg
tatgatgagaagactgctacttgggttcctgataatcccaagattgatgttgggattggc
ttgagatacgattatgggttattctatgcgtccaagtctttctttgatcataagaaagga
agaagagttttgtggggttggattggagaagctgacagtgaatatgctgacgttcagaag
ggatgggcatcattgcaaggaattccaaggactgttttgtttgataacaaaactggaacc
aatttactccaatggccagtggaggagatagaaaacttgagacaaagaagccatgccttc
cacaatttggtgatccatccaggatcggtggtaccccttgaagttggctcatcaactcag
ctagatatttttgctgagttcgagttggacaaggaggctgtggcaaaggcaattgaaacc
aatgtagaattcagctgtcaaagaaggggtggggcagctatccgtggcgcattgggacca
tttggtcttttggtacttgcagacgagaccctcagcgagcatactccagtctacttttat
gttgcaaaaggccaaaatggtactctcaagactttcttttgcactgatgaatcaagatcc
tcggaggctaacgacgtttacaagccaatttatggaagttccgttccagtactagagggt
gaaaagttctctttaagaatacttgttgatcattcagtggtggaaagttttgctcaaggt
ggaagaacttgcatcacatcaagagtttatccaacaaaagccatctatggtgctgcacgg
ctcttcgtattcaacaatgctaaggatacgaatattacagcctccctcacgatatggcag
atgaatcctgcatttatccgcccataccaccccggtggagatcacgactcatccaaaagt
tgtgtggtcttgttaccaatctacctgttcctactagtttcattgttgcatctgattaaa
tgggatgtgcaagtttga

DBGET integrated database retrieval system