KEGG   Cucumis sativus (cucumber): 101215687Help
Entry
101215687         CDS       T02486                                 

Definition
(RefSeq) 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic-like
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00500  Starch and sucrose metabolism
csv01100  Metabolic pathways
csv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101215687
Enzymes [BR:csv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     101215687
Exosome [BR:csv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101215687
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 101215687
NCBI-ProteinID: XP_004144236
UniProt: A0A0A0KGQ9
Position
6
AA seq 850 aa AA seqDB search
MLLSSCVLPSTAVASLSLSAKKIIISDSRNQWPSLRQQTELNFWSRMSHHRQMNPFVFPY
STYKRVHSPAISSVMTEDTSTVSSTDESMENIGILSHDPGLKPFKDHFKYRVGRYTDLLN
LLDKHEGGLDEFARGYLKFGFNREEDGIVYREWAPAAQEAQIVGDFNGWDGTNHCMEKNE
FGIWSIKVYDLGGKPAISHNSRVKFRFKHGNGVWIDRIPAWIKYATVDPTKFAAPYDGVY
WDPPPLERYEFKHPRPAKPNAPRVYEAHVGMSSSEPRVNSYREFADFVLPRIKENNYNTV
QLMAIMEHSYYASFGYHITNFFAVSSRSGTPEDLKYLIDKAHGLGLRVLMDVVHSHASNN
VTDGLNGFDVGQSSQDSYFHTGDRGYHKLWDSRLFNYANWEVLRFLLSNIRWWLEEYQFD
GFRFDGVTSMLYHHHGINMGFSGNYNEYFSEATDVDAVVYLMLANNLTHSILPDATVIAE
DVSGMPGLGRPVFEGGIGFDYRLQMAIPDKWIDYLKNKSDEEWSMGEISWNLTNRRYSEK
CISYAESHDQSIVGDKTIAFLLMDKEMYSGMSCLENASPVVERGIALHKMIHFITMALGG
EGYLNFMGNEFGHPEWIDFPREGNGWSYDKCRRQWNLPDTDHLRYKFLNAFDSAMNALDE
KFSFLASSKQIVSWTGEEDKVIVFERGDLVFVFNFHPVNTYDGYKVGCDLPGKYRVALDS
DASDFGGHGRVGHDIDHFTSPEGIPGVPETNFNNRPNSFKILSPARTCVVYYKVDESKEK
EKDDLVGSANEDVFARHVEEDSEGLAGCKEENDIAVGEISKTEDDDIDTSKPEDDDVDSN
KIEDLPVRGE
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atgctgctttcttcttgtgttcttccttcaactgctgttgcttctttgtcactttcggca
aagaaaattatcatttcggactcgagaaatcaatggccttcactgagacaacaaactgag
ctgaatttttggtctaggatgtcgcatcaccggcagatgaacccatttgtttttccatat
tcaacttacaaaagggttcacagtcctgctatatcttctgtcatgacagaggatacatca
acagtgtcatctactgatgaaagcatggagaatattggcatcttgagccatgatccaggc
ttgaaacccttcaaagatcatttcaagtacagagtagggagatacactgatctactaaac
cttctagataagcatgaaggaggtcttgacgaatttgcacgaggatacctaaaatttgga
tttaatagagaagaagatggcattgtgtatcgtgaatgggctccagctgctcaggaggca
caaattgttggtgactttaacggatgggatgggaccaaccactgtatggaaaagaatgaa
tttggcatttggagtataaaagtttatgatctaggtgggaaacctgccatttctcacaat
tcaagagttaagttccgtttcaagcatggaaatggagtatggattgatcggatacctgct
tggattaaatatgccactgtagatcctactaaatttgcagcaccatacgatggtgtatat
tgggacccacctcctttggaaaggtatgagtttaagcatccacgccctgcaaagcccaat
gccccacgagtgtacgaagctcatgttgggatgagtagctcagaaccacgagttaattca
tacagagaatttgctgactttgttttgcctcgtattaaagagaacaactacaatacagtc
caattgatggctattatggagcattcgtattatgcatcatttgggtatcacattactaac
ttttttgctgtaagcagtagatctggaactcctgaggacctaaaatatcttattgacaag
gcccatggcttgggtttacgggtgttgatggacgttgttcatagccatgcaagtaacaat
gtcactgatggccttaatggctttgatgttggtcaaagttcacaagattcctatttccat
actggagatcgtggttaccataagctgtgggatagtagactctttaattatgccaactgg
gaagttctacgtttccttttatcaaacataagatggtggttggaggagtaccaatttgat
ggctttcgatttgatggtgtaacttcaatgctgtatcatcaccatggaatcaacatgggt
tttagtggaaattataatgagtactttagtgaagcaacggatgttgatgctgttgtgtat
ctgatgctagcaaataatctgactcacagcattttgccagatgcaactgtaattgctgaa
gacgtttcagggatgcctggtcttggaagacctgttttcgaagggggtattggttttgac
taccgcctccaaatggccattcctgacaaatggattgattacttgaagaacaaaagtgat
gaggaatggtccatgggggaaataagttggaacttgacaaatagaagatattcagagaag
tgtatatcttatgctgagagtcatgatcagtcgattgttggagacaagactattgcattt
ctgctgatggataaagaaatgtattctggcatgtcttgtttggaaaatgcatctcccgtc
gttgaaagagggattgccctgcacaagatgatacattttataaccatggccttagggggg
gaaggctatcttaatttcatgggaaacgagttcggtcatcctgagtggattgacttccca
cgagaaggtaatggttggagttatgacaagtgtagacgacaatggaatctgcctgacaca
gaccacctgagatacaagtttttgaatgcttttgacagtgcaatgaacgcccttgacgag
aagttttccttccttgcatcaagtaagcagattgtgagctggacaggtgaagaagataag
gtgatcgtctttgaacgtggagacctggtgttcgtgttcaactttcatcccgtaaacaca
tatgacggatacaaagtcgggtgtgatttacctggaaaatacagagtcgcacttgatagc
gatgcttcggactttggcggacatggaagagtaggccacgacattgaccatttcacatcc
ccagaaggaatccctggagtgccagaaacaaattttaacaaccgacccaactccttcaaa
attctttcaccagctcgaacgtgtgtggtgtactacaaagttgatgaaagcaaagaaaaa
gaaaaagacgatttagttggtagtgcgaatgaggatgtttttgcgaggcatgtagaggag
gacagtgaagggttggcaggttgcaaagaagagaatgacattgctgtaggcgagatttca
aaaactgaagacgatgatattgatacgagcaaacccgaagatgatgatgttgactcgaac
aagattgaagatttgccagtgagaggtgagtag

DBGET integrated database retrieval system