KEGG   Cucumis sativus (cucumber): 101215997Help
Entry
101215997         CDS       T02486                                 

Definition
7-dehydrocholesterol reductase-like
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    101215997
Enzymes [BR:csv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     101215997
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 435 aa AA seqDB search
MAEGSNTVHSPFLTYVSMLSLLTLCPPFVILLWYTMVHADGSVSQTWNYLYQNGFEGFIN
IWPSPSATACKIIGCYAAFEAALQLLLPGKRVLGPVSPTGNQPVYKANGVAAYIVTLLTY
VALWRFGIFDPAIVYDHLGEIYSTLIFGSFIFCILLYIKGHVAPSSSDSGSSGNVILDFY
WGMELYPRIGKHFDIKVFTNCRFGMMSWAVLAVTYCIKQYEKNGTLADSLLVNTALMLVY
VTKFFWWEAGYWNTMDIAHDRAGFYICWGCLVWVPSVYTSPGMYLVNHPVNLGTQLAVSI
LVAGILCIYINYDCDRQRQEFRRKNGKCLVWGKAPSKIVATYTTTTGETRTSLLLTSGWW
GLARHFHYVPEILAAFFWTVPALFHHFLPYFYVIFLTILLFDRAKRDDDRCRSKYGKYWK
LYCEKVPYKIIPGIY
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaggatccaacactgtacactcacccttcctcacttatgtttccatgttatct
cttctcactctctgccctccctttgttatcttactatggtacaccatggttcatgctgat
gggtctgtttctcagacttggaattacttatatcaaaatgggttcgagggatttattaat
atatggccatcgccctctgctactgcttgcaagataattggatgttatgctgcctttgag
gctgctcttcagcttcttttacctggaaagagggttttgggcccggtctctccaacggga
aatcaacctgtttacaaggcaaatggcgtggctgcctacatagtgacactgcttacttat
gttgctctttggcggtttgggatatttgatccagctattgtttatgatcatctgggagaa
atatattcgactcttatttttggaagcttcatcttttgtattcttctatacataaaaggt
catgtggcgccatcttcctctgattcaggttcctctggaaacgttatacttgatttctac
tggggcatggaattgtacccgcgtattggcaaacattttgatattaaggttttcacaaac
tgcagatttgggatgatgtcttgggccgtccttgctgtgacctattgcataaagcaatat
gaaaagaacgggacactagctgattcgttgcttgtaaatactgcattgatgttggtttat
gttacgaagtttttttggtgggaagcagggtactggaacacaatggacatagcgcatgat
agagctggtttttatatttgttggggatgcttggtatgggttccgtctgtgtatacctct
cctggcatgtatttggtcaaccatcctgtaaaccttggcactcagttggcagtatctatt
ctagtagcgggcattctttgcatatatatcaactacgattgtgacagacagaggcaagaa
tttcgcagaaaaaatgggaagtgcttggtttggggaaaagctccatcaaagatagtcgct
acatataccactacaactggggaaaccagaactagtcttcttttaacctctggatggtgg
ggtttagcacggcattttcattatgtcccagaaattttggctgcatttttctggacggtt
ccagccctttttcatcattttctaccatacttctatgtgatatttcttactatccttctg
ttcgaccgagctaaaagggacgacgatcgatgtcgctccaagtacgggaaatattggaaa
ctctactgcgagaaagtgccttacaaaatcatacctggaatatactaa

DBGET integrated database retrieval system