KEGG   Cucumis sativus (cucumber): 101216247Help
Entry
101216247         CDS       T02486                                 

Definition
4-alpha-glucanotransferase DPE2-like
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:csv00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 966 aa AA seqDB search
MVNLGLFSGAKRAKSVNVRFKLPYYTHWGQSLVVCGSDSLVGSWNVKKGLLLSPVHQGDQ
LIWCGSIAVSDGFECEYNYYVVDDNRNVLRWEKGNRRKVLLPQGLQGAEVIELRDLWQTG
GDAIPFKSAFKDVIFGRSSTLSIERPLGNFVHSLDEDDSVLVHFKICCPNIEEDTTIYVI
GSSSKLGQWKVQNGIKLSHAGDSIWHGDCILQFSDFPLKYKYCKYGKAGVISSEFGQNRD
LLLDASNFPPRYILLSDGMLRDLPWRGSGVAIPMFSVRSDDDLGVGEFLDLKLLVDWAVE
SGLHLVQLLPVNDTSVHGMWWDSYPYSSLSVFALHPLYLRVQALSDNIPEDIKLEIQKAK
VELDGKDVDYEATMAAKLTLAQKIFAREKDSVLNSSSFQKYLSENEEWLKPYAAFCFLRD
FFETSDHSQWGRFSQFSKDKLEKLISKDSLHYEVICFHYYIQYHLHQQLSEAANYGRKKG
VILKGDLPIGVDKNSVDTWVYPTLFRMNTSTGAPPDYFDKNGQNWGFPTYNWEEMSKDNY
AWWRARLTQMSNYFTAYRIDHILGFFRIWELPEHAMTGLVGKFRPSIPLSQEELEREGIW
DFDRLSRPYIKAEFLQDKFGAAWGFIASHFLNEYQKNFYEFKEECNTEKKIASKLKSLIE
ETQLQNPDQIRRSLFDLIQNIVLMRDLENPRSFYPRFNLEDTSSFNDLDDHSKDVLKRLY
YDYYFHRQEDLWRKNALKTLPVLLDSSDMLACGEDLGLIPSCVHPVMEELGLIGLRIQRM
PNEPDLEFGIPSQYSYMTVCAPSCHDCSTLRAWWDEDEERRQRFMKNVIESDILPPSQCI
PEIAHFIIKQHFEAPSMWAIFPLQDLLALKEEYTTRPAKEETINDPTNPKHYWRFRSHVT
LESLMKDKELQATIKGLSLESGRSVPHDEAKPASKPTSVDVEANEEKISLATKSNGKPQK
ETLAVT
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atggtgaatttgggattgttttctggagccaaacgtgctaagtcggtgaatgtgagattc
aaattgccatactatactcattggggtcaaagcttggtagtttgtggctctgactccttg
gttggttcgtggaatgtgaagaaggggttgttactgagtcctgttcaccaaggagatcag
cttatatggtgtggaagtattgcggtgtctgatggatttgaatgtgagtacaattattat
gttgttgatgacaatagaaacgtcttgagatgggagaagggaaacaggagaaaggtgttg
ttacctcaaggattacagggtgcggaggtcatcgagctccgtgatctttggcagactggt
ggagatgcgattcctttcaagagtgcctttaaagatgtcatctttggaagaagttcaact
ttgagcatagaaagaccactaggaaatttcgttcatagtttggatgaagatgactctgtt
cttgtccatttcaaaatttgctgtccaaatatagaagaagatacaacaatctatgtcatt
ggtagttcttcgaaattaggacagtggaaggtacagaatggaattaaacttagccatgcg
ggtgactcaatctggcatggagactgcatcttacaattcagcgatttccccttaaagtac
aagtattgtaaatatggaaaagcaggagttatttcttcagaatttgggcaaaaccgggac
cttctccttgatgcttcaaattttccaccaagatatattttactttcagatggcatgttg
cgagatcttccttggcgtggttctggtgttgcaatccccatgttctctgttagatcagac
gatgatcttggagttggcgagtttcttgacttgaaattacttgttgactgggctgtggag
tctggtctccatttagttcaacttctacctgttaatgatacatccgtccatggaatgtgg
tgggactcgtatccttacagttcactttccgtctttgccctgcatccattgtacttgaga
gtccaagcactatcagataatattccagaggatatcaagctggagattcaaaaggcaaaa
gttgaactggatggaaaggatgtggattatgaggcgactatggctgctaagcttacgctt
gcacagaaaatttttgctcgagagaaagattcagtattgaattccagttcctttcagaag
tatctttctgaaaacgaggaatggctaaaaccctatgccgcgttctgttttctgcgagac
ttcttcgaaacatcagatcacagccaatggggtcgtttctctcaattttcgaaagacaag
cttgagaagcttatctcaaaggacagcttgcattatgaagtcatctgcttccactattat
attcaatatcatttgcaccaacagttgtcggaggcagcaaattatggaagaaagaaagga
gtgatattgaaaggcgatcttccgattggtgtcgataagaatagtgtagacacctgggtt
taccctactttattccgtatgaacacgtcaaccggagcacctccagattactttgacaaa
aatggacaaaattggggatttccaacatacaactgggaggagatgtcaaaagataactat
gcttggtggcgcgctcgtttaactcagatgtcaaactacttcacagcttacagaattgat
catatattgggtttctttcgaatttgggagcttccagagcatgctatgaccggtttagtt
ggaaaattccgcccttctattccgttaagccaggaagagctcgaaagagagggaatatgg
gactttgatcgcttgagtcgtccatatatcaaggctgaatttttacaggataaatttgga
gctgcatgggggtttattgcgtctcactttctgaatgaatatcagaagaacttttatgag
ttcaaggaggaatgtaacacagagaaaaaaattgcctccaaactgaagtcacttattgaa
gagacacagttgcaaaacccagaccagatacgacgcagtctttttgatcttatacagaac
atagttcttatgagagacctagagaatccaagaagtttctatccacgcttcaatcttgaa
gatacttctagctttaatgatttggatgatcacagtaaggatgttctgaaaagattatac
tatgactactacttccaccggcaagaggatctttggcggaaaaatgctttaaagaccttg
cctgttctccttgactcttctgacatgctggcctgtggagaagatcttggtctcattcct
tcatgtgttcatcctgttatggaggagttgggattaattggtttacggattcaacgtatg
ccaaatgaacctgatctagagtttgggatcccttctcaatatagctacatgactgtgtgt
gctccatcctgccatgactgctcgactttgcgtgcttggtgggatgaagacgaagaaaga
agacaacggttcatgaagaacgttatagaatctgatatattgccacctagccaatgtatt
ccagagatagcacatttcatcataaagcagcattttgaagctccatctatgtgggctatc
ttcccacttcaggacctattagcactgaaagaggaatacacaacacgacctgcaaaagag
gagacgatcaatgaccctacaaatccaaagcactattggagattccgtagtcatgtgaca
ttagaatctctaatgaaggataaagaactccaagcaaccatcaaaggtctttcccttgag
agtgggagatcggttcctcatgatgaagccaaaccagcatcaaaaccaacatctgtagat
gttgaagctaacgaagaaaagatatctctagcaacgaagtccaatggaaaaccacaaaag
gagacactcgcagtcacatga

DBGET integrated database retrieval system