KEGG   Cucumis sativus (cucumber): 101216516Help
Entry
101216516         CDS       T02486                                 

Definition
protein disulfide-isomerase-like
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:csv00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101216516
Enzymes [BR:csv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101216516
Exosome [BR:csv04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101216516
  Exosomal proteins of colorectal cancer cells
   101216516
  Exosomal proteins of bladder cancer cells
   101216516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 510 aa AA seqDB search
MASSSFIRFFVVASLLFSASFFAIYAEDAASKEFVLTLDNSNFSDVVSKHDFIVVEFYAP
WCGHCKSLAPEYEKAASVLSSHDPPITLAKVDANEESNRELATQFEIRGFPTIKILRNGG
KSSQDYKGPRDADGIVNYLKKQSGPASAEIKSAEDASNLIKDVYIVGIFPKLSGDEFNNF
KALAEKLRTDYDFGHTLDAKLLPRGETSVSGPVVRLFKPFDEQFVDFKDFDPAKLEKFIE
SSSIPTVTEFNNDPSNHVYLSKFFSSSNDKAMFFLNYTTEAADSLKSKYREVAEQYKGEI
SFLIGDSESSQAALNYFGLKEDQVPVLLVQKDDRFKYVKFNVEADQIAPWVKDYKNGKVP
QFIKSEPIPESNNEPVKVVVADSIQDVVYKSGKNVLLEFYSPWCGHCKKLAPTLDEVAVS
YESDPDVVIAKFDATANDIAVGDFEVQGYPTLYFRSASGKLVEYNGDRSKEDIINFIETN
RDKTAEDTKPKDTESKPKESKQDSEAKDEL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcatctttcattcgattctttgtggttgcttctcttctattctctgcttct
ttctttgcgatctacgctgaagacgctgcgtccaaggaatttgttcttactttggacaat
tccaacttctccgatgttgtttccaaacatgacttcatcgtcgttgagttttacgcccct
tggtgtgggcattgtaagagcctggcaccagagtatgaaaaagctgcctctgttttgagc
agtcacgaccctccaattactttagccaaagttgatgccaacgaggagtcaaacagagag
ttggcaactcaatttgaaattagggggttccccaccattaagatactcagaaatgggggt
aaatcaagtcaagattacaagggacctcgcgatgccgacggcattgttaactacttgaag
aagcaaagtgggccggcatctgctgaaataaaatctgcagaggatgctagtaatctcatc
aaggatgtatacattgtcgggatatttccaaagctttctggagacgagtttaataacttc
aaagctttggctgagaagttacgtactgactatgattttggtcacactttggatgctaag
ctacttccgcgtggagaaacatctgtatctggcccagttgttaggcttttcaagccattc
gatgaacagtttgttgattttaaggattttgatccagctaagttggagaagttcattgaa
tcatctagtattcccactgtaacggagttcaataatgatcctagcaatcatgtatacctt
tccaagttcttctccagttctaatgataaggctatgttttttctgaactacaccaccgag
gctgctgattctttgaaatctaagtaccgtgaagttgctgaacagtacaaaggagaaata
agtttcctaattggagacagcgaatccagtcaagctgctctaaactattttggactcaag
gaagatcaagtgcctgtccttcttgtgcaaaaagatgataggtttaagtatgtgaaattc
aatgtggaggctgatcagattgctccttgggtgaaggattacaagaatggcaaagtgcca
caattcataaagtcagaacccattcccgagagtaacaatgaacctgtgaaagtggttgtt
gctgatagcatccaagatgtagtctataaatcaggaaagaatgttttactggaattttat
tctccatggtgcgggcactgcaaaaaacttgctccaaccttagacgaagtggctgtctca
tatgaaagtgatcctgatgtcgttattgctaagtttgatgccacggcaaacgacattgca
gttggcgattttgaagtccaaggttaccctactttgtatttcagatcagcaagcggaaag
ctggtcgagtataatggtgatagatccaaggaagacatcataaatttcattgagacaaat
cgtgataaaactgcagaggatacaaaacctaaggacacagagtcaaaacccaaggaatca
aagcaagattcagaagccaaggatgagctctaa

DBGET integrated database retrieval system