KEGG   Cucumis sativus (cucumber): 101217270Help
Entry
101217270         CDS       T02486                                 

Definition
thymidine kinase-like
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    101217270
Enzymes [BR:csv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     101217270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 244 aa AA seqDB search
MFTQLSNFFTFKTPTISLPSKGFFSTQNRNPQMRASLSPPSGEIHVILGPMFAGKTTTLL
RRIQSESCNGRSVAIIKSNKDTRYGLDSIVTHDGMKLPCWAIPNLSSFKKKFGQGSYDKL
DVIGIDEAQFFDDLYDFCCEAADIDGKTVIVAGLDXXXXRRNFGSVLDIIPLADSVTKLT
ARCEICGNRAFFTLRKTQEKETELIGGADMYMPVCRQHYVSGQVAIETARTVVESRKVGY
RTPA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgttcacccaactctccaattttttcactttcaaaacacccactatttcgttgccctcg
aaagggtttttttcaacccagaatcgaaacccccagatgagggcctctttgtcaccgccc
tctggcgagattcatgtcattctggggccgatgtttgctgggaaaactaccactcttctt
cggcggattcagtccgagagctgcaatggcagaagtgtagctataattaagtcgaataaa
gacacaaggtatggattggattctattgttacacatgacggcatgaaactcccttgctgg
gcaataccaaacttatcatctttcaaaaagaaatttggtcaaggttcttatgacaagcta
gatgtgattggaattgatgaagctcaatttttcgacgatctatatgatttctgttgcgaa
gctgctgatattgatggcaaaacagttatagttgctgggctggatnnnnnnnnnnacagg
aggaacttcggttcagttctcgatataattcctcttgccgattctgtaaccaagttaact
gctcgatgtgaaatctgcgggaatagggctttctttactttaaggaagacacaagaaaaa
gagactgagctgattggtggtgctgatatgtacatgcccgtatgtcgacaacattacgtc
agcgggcaagtagcgatagagacagcaagaactgtagtagaatcacgcaaggttgggtat
aggactccagcatag

DBGET integrated database retrieval system