KEGG   Cucumis sativus (cucumber): 101217270Help
Entry
101217270         CDS       T02486                                 

Definition
thymidine kinase-like
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
csv  Cucumis sativus (cucumber)
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:csv00240]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 244 aa AA seqDB search
MFTQLSNFFTFKTPTISLPSKGFFSTQNRNPQMRASLSPPSGEIHVILGPMFAGKTTTLL
RRIQSESCNGRSVAIIKSNKDTRYGLDSIVTHDGMKLPCWAIPNLSSFKKKFGQGSYDKL
DVIGIDEAQFFDDLYDFCCEAADIDGKTVIVAGLDXXXXRRNFGSVLDIIPLADSVTKLT
ARCEICGNRAFFTLRKTQEKETELIGGADMYMPVCRQHYVSGQVAIETARTVVESRKVGY
RTPA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgttcacccaactctccaattttttcactttcaaaacacccactatttcgttgccctcg
aaagggtttttttcaacccagaatcgaaacccccagatgagggcctctttgtcaccgccc
tctggcgagattcatgtcattctggggccgatgtttgctgggaaaactaccactcttctt
cggcggattcagtccgagagctgcaatggcagaagtgtagctataattaagtcgaataaa
gacacaaggtatggattggattctattgttacacatgacggcatgaaactcccttgctgg
gcaataccaaacttatcatctttcaaaaagaaatttggtcaaggttcttatgacaagcta
gatgtgattggaattgatgaagctcaatttttcgacgatctatatgatttctgttgcgaa
gctgctgatattgatggcaaaacagttatagttgctgggctggatnnnnnnnnnnacagg
aggaacttcggttcagttctcgatataattcctcttgccgattctgtaaccaagttaact
gctcgatgtgaaatctgcgggaatagggctttctttactttaaggaagacacaagaaaaa
gagactgagctgattggtggtgctgatatgtacatgcccgtatgtcgacaacattacgtc
agcgggcaagtagcgatagagacagcaagaactgtagtagaatcacgcaaggttgggtat
aggactccagcatag

DBGET integrated database retrieval system