KEGG   Cucumis sativus (cucumber): 101217425Help
Entry
101217425         CDS       T02486                                 

Definition
(RefSeq) probable choline kinase 1
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
csv  Cucumis sativus (cucumber)
Pathway
csv00564  Glycerophospholipid metabolism
csv01100  Metabolic pathways
Module
csv_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:csv00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101217425
Enzymes [BR:csv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     101217425
    2.7.1.82  ethanolamine kinase
     101217425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 101217425
NCBI-ProteinID: XP_004139690
UniProt: A0A0A0K7Z0
Position
7
AA seq 346 aa AA seqDB search
MAIKSKGITKGNLPEELKKLLRAVASEWGDKIEEMEEGLEVSRLTGAMTNEVYEMKWMSS
RSGDEPRKVVVRVYGEGTEIFFNRDDEIRTFECVSKHGRGPRLLGRFSHGRIEEFINAKT
LSARDLRDPKISARIASKLREFHNLDMPTPITVVLWDRMRNWLKEAKRLSSPHEMEEFCL
EKLDEEIDLLQRELSKDSQPIGFCHNDLQYGNIMMDEDTSSLTLIDYEYASYNPIAYDIA
NHFCEMAADYHSKTPHILDYTSYPDVEERKRFVSAYLGTSGENDHKEEEVEKLLEDAERY
TLANHLFWGLWAIISSHVNKIDFDYFEYAKQRFDQFWLRKSELLVS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcaataaaatcgaaaggaatcacaaaaggcaatttgccagaggaattaaagaaattg
cttagggcggtagcatcggaatggggagacaaaatcgaggagatggaagaaggtttggaa
gtgagtcgattaacaggagcgatgacgaacgaagtgtacgaaatgaaatggatgagttca
agaagtggtgatgaaccacggaaggttgtggtgagagtgtacggagaaggaactgagatt
ttcttcaatagagatgatgagatcagaacgtttgaatgcgtgtcgaaacatggccgtgga
cctcgtcttcttgggcgattctctcatggaagaattgaagagttcatcaatgccaagaca
ctatcagcaagagatcttcgagatccaaaaatatcagcacgaatagcaagtaaattaagg
gagtttcacaatcttgacatgcctactccaataacggttgtcctttgggatagaatgaga
aattggctaaaggaagccaaaagactaagttcaccacatgaaatggaagagttctgcttg
gagaaattggatgaggaaatagatttgcttcaaagggaactctcaaaagattctcaaccc
attggcttttgtcacaatgacttgcaatatggcaacatcatgatggatgaagacacatca
tcactaacccttattgattatgagtatgcaagttacaacccaatagcttatgacatagca
aatcatttttgtgaaatggcagcagattaccactctaagactccccatattttggactat
acatcatacccagatgttgaggaacgtaaaagatttgttagtgcatatctgggcacatca
ggtgaaaatgatcacaaggaagaagaagtggagaagctactagaggatgctgagagatac
actttagcaaatcatctcttttggggattgtgggctatcatttcaagccacgtaaacaag
attgattttgactactttgagtatgctaagcagaggtttgatcaattctggctaagaaag
tctgagctcttagtttcttga

DBGET integrated database retrieval system